(data stored in ACNUC1104 zone)

EMBL: AP008957.CFA

AP008957.CFA         Location/Qualifiers
FT   CDS_pept        complement(433085..434386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="RER_03830"
FT                   /product="putative cyclopropane fatty acid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="protein synonym:cyclopropane-fatty-acyl-
FT                   phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31091"
FT                   /db_xref="GOA:C0ZN39"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN39"
FT                   /protein_id="BAH31091.1"
FT                   /translation="MTTFKDSKSQDKLSIAEILETLSDGMLPLRFTAYDGSTAGPEDAD
FT                   YGLHLKSTRGTTYLATAPGDLGMARAYVSGDLEAEGVHPGDPYEILRIMGDELHLKRPS
FT                   ALTLASITRSLGWDLLRPIAPPPQEHLPRWRRVAEGLRHSKTRDAEVIHHHYDVSNTFY
FT                   EYVLGPSMTYTCAAYDNAEQTLEEAQENKYRLVFEKLGLQKGDRLLDIGCGWGSMVRYA
FT                   ARRGVKVIGVTLSREQADWAQKAIEDEGLADLAQVRFSDYRDVAETGFDAVSSIGLTEH
FT                   IGVGNYPAYFEFLKGKLREGGRLLNHCITRPDNRSSAKAGGFIDRYVFPDGELTGSGRI
FT                   ISEIQNVGLEVRHEENLREHYALTLAGWCQNLVDNWDACVAEVGEGTARVWGLYMAGSR
FT                   LGFERNVVQLHQVLAVKLGPKGEAHVPLRPWWKA"
     atgaccacgt tcaaagactc caaaagccag gacaagctct ctattgccga gattctcgag        60
     acgctttccg acggcatgct gccgcttcga ttcaccgcgt acgacggcag caccgccggc       120
     cccgaagatg ccgactacgg actgcacctc aagtcgactc gcggaaccac ttatctcgca       180
     acggcgcccg gcgatctcgg catggcccgc gcgtacgtct ccggcgatct cgaagccgag       240
     ggtgttcacc ccggtgatcc gtacgagatc ctgcgcatca tgggtgacga actccacctc       300
     aagcgcccgt ctgcactgac actcgccagc atcacccgct cactgggctg ggatctgttg       360
     cggcccatcg ccccgccgcc ccaggaacac cttcctcgct ggcgtcgcgt cgcagaagga       420
     ctgcgtcact ccaagactcg tgacgccgaa gtcatccatc accattacga cgtctccaac       480
     accttctacg agtacgtcct cggcccgtcc atgacgtaca cctgtgccgc ctacgacaat       540
     gcggaacaga cgctcgaaga agcccaggag aacaagtacc gcctggtgtt cgagaagctc       600
     ggactccaga agggtgatcg acttctcgac atcggttgcg gctggggctc gatggttcgc       660
     tacgcggccc gacgcggcgt caaggtgatc ggcgtgactc tctcacgcga gcaagcggat       720
     tgggcacaga aggccatcga ggacgagggc ctcgccgatc tcgcccaggt ccgtttctcc       780
     gactaccgcg acgtggccga aaccggattc gacgcagtgt cctccatcgg cctgaccgag       840
     cacatcggcg tcggaaacta cccggcgtac ttcgagttcc tcaagggcaa gctgcgtgaa       900
     ggtgggcgcc tgctcaacca ctgcatcacc cgtccggaca accgaagcag tgccaaggca       960
     ggcggattca tcgaccggta cgtcttccca gacggggagc tcaccggttc gggtcgcatc      1020
     atctccgaga tccagaacgt cggtctcgag gtgcgccacg aggagaacct gcgcgagcac      1080
     tacgcactga cgctcgccgg atggtgccag aatctcgtcg acaactggga cgcctgcgtc      1140
     gccgaggtcg gcgagggaac cgcacgcgtc tggggcctgt acatggccgg ctcacgactc      1200
     gggttcgagc gcaacgtcgt tcagctgcac caggttctgg ccgtcaagct cggccccaag      1260
     ggtgaggcgc atgtgccgct tcgcccgtgg tggaaggcct ag                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page