(data stored in ACNUC1104 zone)

EMBL: AP008957.CLPC

AP008957.CLPC        Location/Qualifiers
FT   CDS_pept        723922..726465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="RER_06460"
FT                   /product="putative ATP-dependent Clp protease ATP-binding
FT                   subunit ClpC"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31354"
FT                   /db_xref="GOA:C0ZPM6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM6"
FT                   /protein_id="BAH31354.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKEPTETGGTRGEAGTP
FT                   STSLVLDQFGRNLTQAALEGKLDPVIGRSKEIERVMQVLSRRTKNNPVLIGEPGVGKTA
FT                   VVEGLAQAIVNGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDII
FT                   LFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRF
FT                   QPVQVGEPTVEHTIEILKGLRDRYEAHHRVSITDGALVAAATLADRYINDRFLPDKAID
FT                   LIDEAGARMRIRRMTAPPDLREFDDRIADARREKESAIDAQDFEKAANLRDKEKTLVAQ
FT                   RAEREKQWRAGDLDVIAEVDDEQIAEVLGNWTGIPVFKLTEEETTRLLRMEEELHKRII
FT                   GQEEAVKSVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELAKSLANFLFGDDDALI
FT                   QIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNT
FT                   LLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISKAVGLGFSSGTGTESNYERMKL
FT                   KVHDELKKHFRPEFLNRIDDIVVFHQLTNEQIVQMVDLMLARVEAALKNKDMAMEVTDK
FT                   AKSLLAKRGFDPVLGARPLRRTIQREIEDQMSEKILFGEIGPGHIVLVDVENWDGEGSG
FT                   EDAKFTFTPTKKPIDVPDAPPIELTKAGESESAAE"
     atgttcgaga ggttcaccga tcgcgcgcgg cgcgttgttg tcctggctca agaagaagcc        60
     aggatgctca accacaacta catcggcacg gagcacatcc ttctcggcct cattcacgag       120
     ggcgaaggtg ttgcagccaa gtcgttggag tcgttgggta tctccctcga gggagtccgc       180
     agccaggtcg aggagatcat cggccagggc cagcaggctc cgtccggtca catccccttc       240
     acaccgcgcg ccaagaaagt cctcgagctg agtctgcgcg aagcgctgca gctcggacac       300
     aactacatcg gtacggagca cattctgctc ggtctcatcc gtgagggtga gggcgtagca       360
     gcccaggttc tggtcaagct cggtgccgat ctcaaccgtg tccgccagca ggtcatccag       420
     ctgctgtcgg gctaccaggg caaggagccc accgaaaccg gtggcacccg cggagaggcc       480
     ggcacgccgt ccacctcgct cgtgctcgac cagttcggtc gcaatctgac gcaagctgcc       540
     ctcgaaggca agctggaccc ggtcatcggc cgctcgaagg aaatcgagcg cgtcatgcag       600
     gttctctcgc gtcgtaccaa gaacaacccg gttctcatcg gtgaacccgg tgtcggtaag       660
     accgctgtgg tcgagggcct ggctcaggca atcgtcaacg gtgaggtccc cgagaccctc       720
     aaggacaagc agctgtacac gctcgacctc gggtcgctcg tggccggcag ccgttaccgc       780
     ggtgacttcg aagagcgcct gaagaaggtt ctcaaggaga tcaacacccg cggagacatc       840
     atcctgttca tcgacgagct gcacaccctc gttggtgcgg gcgcggccga gggcgctatc       900
     gacgcggcct ccatcctcaa gcccaagctt gcccgcggtg agctgcagac catcggtgct       960
     accactctcg acgagtaccg caagtacatc gagaaggatg ccgctctcga gcgtcgtttc      1020
     cagcccgttc aggtgggcga gccgaccgtc gagcacacca tcgagatcct caagggtctt      1080
     cgtgaccgct acgaggctca ccaccgtgtc tccatcacgg acggtgctct cgtggcagcg      1140
     gcgacgctgg ccgaccgcta catcaacgac cgcttcttgc cggacaaggc gatcgacctc      1200
     atcgacgagg cgggcgcgcg aatgcgcatc cgtcggatga ctgcaccgcc ggacctgcgc      1260
     gaattcgacg atcgcatcgc cgacgcgcgt cgcgagaagg agtccgcgat cgacgcgcag      1320
     gacttcgaga aggctgcgaa cctgcgtgac aaggagaaga ccctcgttgc tcagcgcgct      1380
     gagcgtgaga agcagtggcg tgcgggcgac ctggacgtca tcgccgaggt cgacgacgag      1440
     cagatcgccg aggttctggg caactggacc ggtatccccg tcttcaagct caccgaggag      1500
     gagaccactc gtctgctccg catggaagag gaactgcaca agcggatcat cggccaggaa      1560
     gaggcagtca agtccgtctc gaaggcgatc cgtcgtacgc gtgcaggtct gaaggatccc      1620
     aagcgtccct cgggctcgtt catcttcgcc ggcccgtccg gtgtcggtaa gacggagctc      1680
     gcgaagtcgc tcgccaactt cctgttcggc gacgacgacg ctctgatcca gatcgacatg      1740
     ggcgagttcc acgaccgctt caccgcttcg cgtctgttcg gtgcccctcc cgggtacgtc      1800
     ggatacgaag agggtggcca gctcaccgag aaggtgcgcc gcaagccgtt cagcgttgtg      1860
     ctgttcgacg agatcgagaa ggcacaccag gagatctaca acaccctcct gcaggtgctc      1920
     gaggacggcc gtctcaccga cggtcaggga cgtaccgtcg acttcaagaa cacggtgctg      1980
     atcttcacgt ccaacctcgg tacgtcggac atctccaagg cagtcggcct gggcttcagc      2040
     tcgggaacgg gcacggagtc gaactacgag cgcatgaagc tcaaggtgca cgacgagctg      2100
     aagaagcact tccgtcccga gttcttgaac cgtatcgacg acatcgtcgt cttccatcag      2160
     ctcacgaacg agcagatcgt tcagatggtc gacctgatgc tcgctcgcgt cgaggcggca      2220
     ctcaagaaca aggacatggc catggaggtc accgacaagg ccaagtcgct tctggccaag      2280
     cgcggattcg atccggtact gggtgcacga ccgctgcgtc gcaccatcca gcgcgagatc      2340
     gaggaccaga tgtccgagaa gatcctcttc ggagagatcg gacccggcca catcgtgctc      2400
     gtcgacgtcg agaactggga cggcgaaggc tcgggcgagg acgcgaagtt cacgttcacg      2460
     cccaccaaga agccgatcga cgtgccggac gcaccgccga tcgagctgac caaggccggc      2520
     gaaagcgaaa gcgcagcaga gtag                                             2544
//

If you have problems or comments...

PBIL Back to PBIL home page