(data stored in ACNUC1104 zone)

EMBL: AP008957.CYSD

AP008957.CYSD        Location/Qualifiers
FT   CDS_pept        complement(149535..150449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="RER_01270"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="protein synonym:ATP sulfurylase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30835"
FT                   /db_xref="GOA:C0ZLK8"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK8"
FT                   /protein_id="BAH30835.1"
FT                   /translation="MSTVTDVVDELRVLESEAVHIIREVVAELERPVLLFSAGKDSIVL
FT                   LRLAEKAFRPSPLPFPVLHVDTGHNFEEVIEFRDRRIKEGGHTLLVASVQDSIDQGRVQ
FT                   ESTETSGSRNRLQTRTLLDALEGGRFDAAFGGARRDEERARAKERVLSFRDEFGQWDPR
FT                   AQRAEPWSLYNGRIRRGESVRVFPLSNWTELDIWRYIAQEELELPPIYFAHERRVFERD
FT                   GMLLAASEFSTDAENAAATTEWVRYRTVGDLTITGAVRSHATTIDDVVTEISAATVSER
FT                   GETRADDRTSVAAMEDRKREGYF"
     atgagcaccg tcaccgatgt tgtcgacgaa ctccgagttc tcgaatccga agcggttcac        60
     atcattcgag aggtggtggc agaactcgaa agaccggtac tgctcttctc agccggcaag       120
     gactcgatag tcctgcttcg actcgccgag aaggcgtttc gaccctcccc actccctttc       180
     cccgtcctac acgtcgacac cggtcacaat ttcgaggaag tcatcgaatt tcgcgaccgc       240
     cgaatcaagg agggcgggca cacacttctg gttgcttccg ttcaggattc gatcgaccag       300
     ggtcgagtac aggagtcgac cgagaccagc ggatcgcgaa accgcctgca gaccagaact       360
     ctgctcgacg ctctcgaagg cgggcgattc gacgccgcat tcggcggcgc ccgccgggac       420
     gaggaacgtg cgcgagccaa ggagcgagtc ctgagcttcc gtgacgagtt cggccagtgg       480
     gaccctcggg cgcaacgggc cgaaccgtgg tcgctctaca acggtcggat cagacgcgga       540
     gagtccgttc gtgtcttccc gctgagcaac tggacagaac tcgacatctg gcgctacata       600
     gcccaggagg aactggagtt gccgcccatc tatttcgcgc acgaacggcg ggtattcgag       660
     cgcgacggaa tgctcctcgc tgcttcggaa ttcagcaccg acgccgagaa cgccgcggca       720
     acgaccgagt gggtgcgata tcgaaccgtc ggcgatctga ccatcaccgg cgccgttcga       780
     tcgcacgcca ccaccatcga cgacgtcgtc accgagatct cggccgcgac ggtttccgaa       840
     cgaggcgaga ctcgcgcaga cgaccgaacc tcggtcgccg cgatggaaga ccgaaagcgt       900
     gagggctact tctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page