(data stored in ACNUC1104 zone)

EMBL: AP008957.CYSS

AP008957.CYSS        Location/Qualifiers
FT   CDS_pept        766964..768358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="RER_06890"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="protein synonym:CysRS"
FT                   /note="protein synonym:cysteine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31397"
FT                   /db_xref="GOA:C0ZPR9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR9"
FT                   /protein_id="BAH31397.1"
FT                   /translation="MTLRLYDTGTRALRDFVPLAPGHASVYLCGATVQGDPHIGHVRSG
FT                   VAFDVLRRWLLAHGNDVAFVRNVTDIDDKILNKAAGAGRPWWEWAATFERSFTWAYDQL
FT                   GVLPPSIEPRATGHVTQMVEMMERLIENGHAYAAGGDVYFDVQSYPEYGALSGHKLDDV
FT                   HQGESAAEGKRDPRDFTLWKAVKPGEPSWPTPWGPGRPGWHLECSAMAEFYLGAAFDIH
FT                   CGGRDLVFPHHENEIAQAKCAGDDFAQYWLHNGWVTMSGEKMSKSLGNVLSVPNVLKKV
FT                   RPQELRYYLGSAHYRSNLEYSDEALDESAKSYQGLESFVLRTHKRAGGVELGTWTEGFA
FT                   AALDNDLSVPIALAEIHGKASEGNSALAAGDLDAARVAAGQVRAMLAILGVDPLDEHWT
FT                   QSGGDTETAMEALDVLVRADLDRRQQARTEKNWAVADEVRDRLIKAGIEVTDTPDGPEW
FT                   SLKAGQ"
     gtgaccctgc gcctatacga caccggtacg cgggcccttc gggattttgt tccgttggcc        60
     cccggacatg catcggtgta cctgtgtggg gcgacagttc agggcgatcc tcacatcgga       120
     cacgttcgta gcggcgtcgc tttcgacgtg ctgcgacgct ggctgttggc gcacggcaac       180
     gacgttgcct tcgtgcgcaa cgtgacggac atcgacgaca agattctcaa caaggccgcc       240
     ggcgccggtc gaccttggtg ggagtgggcg gcgacgttcg agcggtcgtt cacgtgggcc       300
     tacgaccaac tgggtgtgct gccgccgtcc atcgagccgc gggccaccgg tcacgtgacg       360
     cagatggtcg agatgatgga acgcctgatc gagaacggcc acgcgtacgc ggcgggcggc       420
     gacgtctact tcgacgtgca gagctacccc gagtacggcg cactgtccgg ccacaaactc       480
     gacgacgttc atcagggcga gagtgcggcc gagggcaagc gcgatcctcg cgacttcacc       540
     ctctggaagg ccgtcaagcc cggtgagccc tcgtggccga caccgtgggg acctggccgt       600
     ccgggctggc acctcgagtg ctcggctatg gcggagttct acctcggggc cgcattcgac       660
     atccattgtg gtggacgcga tctcgtcttc ccacaccacg agaacgaaat tgcgcaggcc       720
     aagtgcgccg gcgacgattt cgctcagtac tggttgcaca acggctgggt cacgatgagt       780
     ggcgagaaga tgtccaagtc gttgggcaac gttctctctg tgccgaacgt gctcaagaag       840
     gttcgtccgc aagaacttcg gtactacctc ggtagtgcgc actaccgttc caatctcgag       900
     tactcggacg aggcgttgga cgaaagcgcg aagtcctacc aggggctcga gtcgttcgtc       960
     ctgcgcacac acaagcgtgc gggtggcgtc gaactcggta cgtggaccga aggtttcgcg      1020
     gcggctctcg acaacgactt gtcggtgccg atcgcgttgg ccgagattca cggcaaggcg      1080
     agcgagggta attccgcgct cgctgccggt gatctcgacg cggctcgggt ggctgccggt      1140
     caggtgcggg ccatgctcgc gatcctgggc gtcgacccac tcgacgagca ttggacgcag      1200
     tccggtggcg acaccgagac ggcaatggaa gctttggacg tgttggtgcg ggccgatctc      1260
     gatcgtcggc agcaggcacg tacggaaaag aactgggcgg tggcggacga ggtccgcgat      1320
     cgcctcatca aggcgggtat cgaagtaacc gatactcccg acggacccga atggtccctt      1380
     aaggcagggc agtaa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page