(data stored in ACNUC1104 zone)

EMBL: AP008957.DNAA

AP008957.DNAA        Location/Qualifiers
FT   CDS_pept        768..2330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RER_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30709"
FT                   /db_xref="GOA:C0ZLE1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZLE1"
FT                   /protein_id="BAH30709.1"
FT                   /translation="MNDDPNALARVWVDVVAELTSDDPGSNLPALSSKQKAFVRLVRPL
FT                   TLAQGFALLSVPSPFAQETIERDLREPILQALGRHLGGQVEGLGVRIALEDDADAPAEP
FT                   VEERTGSRQFESVNSSGAYRRRRFTEGDGEPSDSETAETEEVDDDREALASVHESWPSY
FT                   FTKPPATPSASGSGANSLNAKYTFDTFVIGSSNRFAHAAAVAIAEAPARAYNPLFIWGA
FT                   SGLGKTHLLHAAGHYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRRYRETDVL
FT                   LVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVVSSDRPPKQLATLEERLRTRFEWGLI
FT                   TDVQPPELETRIAILSKKARMDRLEVPHDVLELIASRIERNIRELEGALIRVTAFASLN
FT                   RQPLDLTLAEVVLRDLMPDSSSLEINAATIMAVTAEYFNMSIDDLCGPGKARPLAQARQ
FT                   ISMYLCRELTDLSLPKIGQTFGRDHTTVMYADKKIRKEMTERRKVYDQVQELTARIKQR
FT                   SKR"
     gtgaacgacg atcccaacgc gctcgcacgg gtctgggtcg acgtggttgc agaactcacg        60
     agtgatgacc ccggaagtaa tcttccggct ttgagcagca agcagaaggc atttgtccgt       120
     ctggtgaggc ctctcacact tgctcagggt tttgcactcc tctcggttcc atcgccattt       180
     gctcaagaga cgatcgagcg cgatctacgc gagccgatcc tgcaggcact cggacgccac       240
     ctcggcggcc aggtcgaggg actcggtgtc cgcatcgcac tcgaagacga tgccgacgca       300
     cccgccgaac cggtcgagga gcgcacgggc agccgtcagt tcgagtcggt caactcatcg       360
     ggcgcatacc gtcggcgcag attcaccgaa ggtgacggcg aaccttcgga ctccgagact       420
     gccgagaccg aagaagtcga cgacgaccgc gaagcactcg cgagcgttca cgaatcgtgg       480
     ccgtcgtact tcacgaagcc gcccgctact ccttctgctt ctgggtccgg cgcgaacagt       540
     ctcaacgcga agtacacctt cgacactttt gtgatcggat cgtccaaccg attcgctcat       600
     gccgctgccg tcgcgatcgc ggaggcgccg gcgcgtgcgt acaacccctt gttcatctgg       660
     ggagcttcgg gcctgggcaa gacgcacctt cttcacgccg ccggccacta cgcacagcga       720
     ctgttccccg gcatgcgggt caagtacgtc tcgaccgaag aattcaccaa cgacttcatc       780
     aacagtcttc gtgacgaccg caaggtcgcg ttcaaacgtc gataccggga aacggacgtc       840
     ctgctggtgg acgacatcca gttcatcgaa ggcaaggaag gtatccagga ggagttcttc       900
     cataccttca acaccttgca caacgcgaac aagcagatcg tcgtctcctc ggaccgtccg       960
     cccaagcagt tggcaaccct cgaggagcgt ctgcggacgc gcttcgaatg gggcctgatc      1020
     accgacgttc agccgcctga gctcgagacg cgtatcgcga ttctgagcaa gaaggcgagg      1080
     atggatcgcc tcgaggtccc gcacgacgtt ctcgagctga tcgccagccg tatcgagcgc      1140
     aacattcgtg agctcgaggg cgcgttgatc cgcgtcaccg cttttgcctc gctcaaccgc      1200
     cagccgttgg atctgacgtt ggccgaggtg gtcctgcgcg atctgatgcc cgattcgtcg      1260
     agcctcgaga tcaacgcggc gacgatcatg gcggtgacgg ccgaatactt caacatgtcg      1320
     atcgacgacc tgtgtgggcc gggtaaggcc cggccgctcg ctcaggcccg ccagatctcg      1380
     atgtatttgt gccgtgagct cactgatttg tcattgccga agatcggtca gacgttcggc      1440
     cgtgaccaca cgacggtcat gtatgccgac aagaagatcc gtaaggaaat gacggaacgc      1500
     cgcaaggtgt acgaccaggt tcaggagttg accgcaagga tcaagcagcg ctccaagcgc      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page