(data stored in ACNUC1104 zone)

EMBL: AP008957.DNAX

AP008957.DNAX        Location/Qualifiers
FT   CDS_pept        415714..417960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="RER_03760"
FT                   /product="DNA polymerase III gamma/tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31084"
FT                   /db_xref="GOA:C0ZN32"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN32"
FT                   /protein_id="BAH31084.1"
FT                   /translation="MALYRKYRPASFAEVVGQEHVTAPLSTALDTGRINHAYLFSGPRG
FT                   CGKTSSARILARSLNCEQGPTSTPCDVCDSCVSLGPGGTGNLDVTELDAASHGGVDDTR
FT                   ELRDKAFHAPAASRYRVFIIDEAHMVTAAGFNALLKIVEEPPEHLIFIFATTEPEKVLP
FT                   TIRSRTHHYPFRLLAPSTMRGLLEKICAQEGVPVEPAVYPLVIKAGGGSPRDSLSVLDQ
FT                   LLAGAGEEGVTYPRALSLLGVTDVALIDEAVDALSASDGAALFGTVDRVMDAGHDPRRF
FT                   ALDLLERLRDLILMQAVSDASERGLVDAPEAELVTMREQIQRVGPATLTRFAETVHAGL
FT                   SEMRGATAPRLLLEVMCARMLLPSASDTESAVLQRLERLEQGIPAAGVAAAAAPRAAAT
FT                   PAPTVPPLEPEIASKFQRPSQRKAEPEARPEPAAPAPAAPPVVEAPVVEPPVAAAPVVE
FT                   PPTVEIVEPPVAEAPVVEAPVVEAPVVEAPVAEAPIVEAPVVEPPAPAPVEAEELIGLA
FT                   EPEPDYEPEPEYEEPAAAEAAPVSAGPTVETLRESWNTLRNKVGERNKVLPAMLSAATV
FT                   HDVRGHVVVIAHGSPVLGARVTQPHNAAVICEVLAEMFGGTWQVEYQEGAPTAPAASSA
FT                   PKATEAASRPAAAPRFSRPSQERAAQQPKAPQSQRGDSDDIPPPEAPDYPEDPGPAPAP
FT                   EVDYEATPPPATPEDEDEMFAEAAEPADPTARRDPEDVAKELLKDVLGARRLES"
     gtggccctgt accggaagta tcgacccgcg tccttcgccg aggtggtggg gcaggagcat        60
     gtcaccgcac cgctcagcac ggccctcgac accggacgca tcaaccatgc ctatctgttt       120
     tccggcccgc gcggctgtgg aaagacgtcg tcggcgcgaa tcctggcgcg ttcgctgaac       180
     tgtgagcagg gaccgacgtc gacgccgtgc gatgtatgcg actcgtgcgt ttcgcttggc       240
     ccgggcggca caggcaacct ggacgtgacg gaactcgacg ccgcaagtca cggtggcgtc       300
     gacgacaccc gagaactccg agacaaggcg ttccacgccc ccgccgcttc tcgctaccgc       360
     gtcttcatca tcgatgaggc acacatggtg acggcggcgg gcttcaacgc gctgctcaag       420
     atcgtcgaag agccgccgga gcacctcatc ttcatctttg cgacgacgga accggaaaag       480
     gttctcccga ccatccgttc gcgtacacac cactacccgt tccgcctgtt ggcgccgtcg       540
     accatgcgcg gactcctgga aaagatctgc gcccaggaag gcgtaccggt cgagcctgct       600
     gtttatcccc tggtcatcaa ggctggcggc ggttcgcctc gcgactcgtt gagtgtcctc       660
     gatcagttgc tcgcgggagc cggcgaagaa ggtgtcacgt atccgcgggc gctctctctt       720
     ctcggagtca ccgacgtcgc gctcatcgac gaagcagtag acgccctgtc tgccagtgac       780
     ggagccgcct tgttcggcac tgtcgatcgg gtgatggacg ccggtcacga tccacgccga       840
     ttcgcgctcg atctcctcga acgtctacgc gatctcattt tgatgcaggc agtctccgat       900
     gccagcgaac gagggttggt cgatgcgccg gaggccgagc tggtcacgat gcgtgaacag       960
     attcagcgag tcggcccggc cacgctcacc cgtttcgccg aaaccgtcca cgctggtctc      1020
     agtgaaatgc gtggggcgac ggcgccgcgg ctgctgctcg aagtgatgtg cgcgagaatg      1080
     ctgcttcctt cggcctccga caccgagtcg gctgtgttgc agcggctcga gcgcctggaa      1140
     caaggtattc cggctgccgg agtcgcggct gccgctgccc ctcgcgcggc agcaacgccg      1200
     gcaccgactg tgccgccgct cgaaccggag attgcttcca agttccaacg gccctcccaa      1260
     cgcaaggccg agcctgaggc acggccggaa ccagccgccc cggctccggc ggcgccgccg      1320
     gtcgtcgagg ctcctgtcgt cgaacctccg gtagcggcag ctcccgtggt cgagcctccc      1380
     accgtcgaga tcgtggaacc gccggttgcg gaagctccag tggttgaagc tccggtggtt      1440
     gaagcaccag tggttgaagc tccggttgcc gaagctccaa tagttgaagc tcctgtggtt      1500
     gaaccaccgg ctcctgctcc ggtcgaagcg gaagagctga tcgggcttgc cgagccggaa      1560
     cccgactacg agcccgagcc cgagtacgag gagccggcgg ctgcagaagc tgcgccggtc      1620
     tcggcgggcc ccacagtcga gaccctccgt gaatcgtgga acaccttgcg caacaaggtc      1680
     ggtgaacgaa acaaggttct tccggccatg ctgtccgctg cgacggttca cgacgtgcgt      1740
     ggacatgttg tggtcatcgc tcacggctcg ccggtcctgg gtgctcgtgt gacgcaaccg      1800
     cacaacgcgg cggtcatctg cgaggtcctt gccgagatgt tcggtggcac ttggcaagtc      1860
     gagtaccaag aaggtgcgcc cacagcgccg gcagcatcga gcgcacccaa ggcgacagaa      1920
     gctgcgagcc gcccggccgc tgcgccccgc ttctcgcgcc ccagtcagga gcgtgcagcg      1980
     cagcagccca aggccccgca gtcccagcgc ggagattcgg acgacattcc gccgcctgag      2040
     gcccccgact atccggaaga ccctggaccg gcccctgctc ctgaggtcga ctacgaggca      2100
     actcctccgc ctgcaacgcc ggaggacgag gacgagatgt tcgcggaggc ggctgagccc      2160
     gctgatccga ctgccagacg tgatcccgag gacgttgcaa aggaactcct caaggacgtc      2220
     ctcggggcac gccgcctcga aagctga                                          2247
//

If you have problems or comments...

PBIL Back to PBIL home page