(data stored in ACNUC1104 zone)

EMBL: AP008957.GLTB

AP008957.GLTB        Location/Qualifiers
FT   CDS_pept        62436..67034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="RER_00510"
FT                   /product="glutamate synthase large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30759"
FT                   /db_xref="GOA:C0ZLJ1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ1"
FT                   /protein_id="BAH30759.1"
FT                   /translation="MKQLPGPQGLYHPSNEHDSCGVAFVVDMHGRRSRDIVEKAITALV
FT                   NLEHRGAAGSEPNTGDGAGILLQVPDKFFRAVVDFALPAEGAYATGIAFLPQGDADAHE
FT                   AAAAVEKIVVEEGLKVLGWREVGTDDSSLGALARDAMPTFRQIFIGSEGDKYTGMDLER
FT                   RAYVVRKRTEHELGSEGAGKGGPGSETVYFPSLSGQTFVYKGMLTTPQLKGFYLDLQDD
FT                   RVESALGLVHSRFSTNTFPSWPLAHPFRRVAHNGEINTVTGNENWMRARESLIDSDVFG
FT                   GRENLDKIFPICTQGASDTARFDEVLEMLHLAGRSLPHAVLMMIPEAWEKHESMDPARR
FT                   AFYEYHSALMEPWDGPASVCFTDGTVIGAVLDRNGLRPSRLWITEDGLVVMASEVGVLP
FT                   IDPSTVVRKVRLQPGRMFLVDTAQGRVISDDELKSELAAEHPYQQWIDEGLIHMDDLPD
FT                   RPYTYMSHERVVLRQQLFGFTSEEVNLLVKPMALSGAEALGSMGTDTPIAVLSSRPRML
FT                   FDYFSQLFAQVTNPPLDAIREEVVTSLGATIGPEGDLLHPNADSCKQIALPQPILHNDD
FT                   LSKLVHVNDDGEFPGFRSVVIRGLYPVKEGGDGIRRALEGIKYQVSQAIEGGARIVVLS
FT                   DRESTEDYAPIPSLLLTSAVHHHLVREKSRTKVGLIVEAGDAREVHHMALLIGFGAAAV
FT                   NPYMAFETIDEFLQNKELEGLTLEKGIANYIKAAGKGVLKVMSKMGISTLASYTGAQLF
FT                   QVIGLSQELTDEYFTGLQSQLGGIGLDQIAADVEARHRIAYLDRPEERAHRELEVGGEY
FT                   QWRREGEYHLFNPDTVFKLQHATRTGQYEVFKEYTTMVNDQSERLAALRGLFDFNIGKR
FT                   PSISIDEVEPASEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGARSNSGEGGEHPSRF
FT                   TPDENGDLRRSAIKQVASGRFGVTSHYLSNCTDIQIKMAQGAKPGEGGQLPAHKVYPWV
FT                   AEVRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPQARIHVKLVSEVGVGTVAAG
FT                   VSKAHADVVLISGHDGGTGATPLTSVKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDG
FT                   QLKTGRDVVVAALLGGEEFGFATAPLVVSGCIMMRVCHLDTCPVGVATQNPLLRQRFSG
FT                   KPEFVENFFMFIAEEVRELLAELGFRTLLEAVGQVDMLDTTRALDHWKGSKAGNLDLSP
FT                   ILTQVESAFMDQDLHCTGTQDHGLDKALDQQLIVSARNALDKGEAVSFESAITNVNRTV
FT                   GTMLGHEVTKAFGGEGLPEGTIDITFTGSAGNSFGAFVPSGMTLRLHGDANDFVGKGLS
FT                   GGRIVVRPPLDAAEGFVAEDNIIGGNVILFGATSGEALLRGVVGERFAVRNSGATAVVE
FT                   GVGDHGCEYMTGGKVVILGATGRNFGAGMSGGVAYIYNPDKAFEKNLNTELVDLEDLSG
FT                   DDFTWLKSVIERHRDETGSEVATRILGDWSQQVGHFAKVMPRDYKKVLLAIAAAEKDGK
FT                   NVDEAVMEAARG"
     atgaagcaac ttccaggccc ccagggcctc tatcacccgt ccaatgagca cgactcctgt        60
     ggagtcgcat ttgttgtcga catgcatggt cgccgcagca gggacatcgt cgaaaaggcg       120
     atcaccgctc tggtcaacct cgagcatcgc ggcgctgccg gatcagaacc caacacgggt       180
     gacggtgcgg gcattctgct gcaggttccc gacaagttct tccgagctgt cgtggacttc       240
     gcgctgcccg ccgaaggcgc gtacgcaacc ggtatcgcat tcctcccgca gggcgacgcc       300
     gatgcacacg aggctgctgc tgcagtcgag aagatcgtcg tcgaagaggg cctgaaggtt       360
     ctcggctggc gcgaggtcgg aacagacgac tcctcgctgg gcgcactggc gcgcgacgcg       420
     atgccgacgt tccgtcagat cttcatcggc tccgagggtg acaagtacac cggcatggat       480
     ctcgagcgtc gtgcgtacgt ggtgcgtaag cgcaccgagc acgaactcgg ctccgaaggc       540
     gccggcaagg gtggcccggg tagcgagacc gtgtacttcc ccagcctgtc cggccagacg       600
     ttcgtctaca agggcatgct caccaccccg cagctcaagg gtttctacct cgatctgcag       660
     gacgatcgtg tcgagagcgc actcggactt gtccactcgc gcttctccac caacacgttc       720
     ccgtcgtggc cgctggcgca cccgttccgc cgggtcgctc acaacggtga gatcaacacc       780
     gtcaccggca acgagaactg gatgcgcgct cgcgagtccc tgatcgacag tgacgtcttc       840
     ggtggccgcg agaacctgga caagatcttc ccgatctgca cccagggcgc cagtgacacc       900
     gctcgtttcg acgaggtgct cgagatgctg cacctcgccg gccgcagcct gccgcacgca       960
     gttctcatga tgatcccgga agcctgggag aagcacgaga gcatggaccc cgctcgtcgg      1020
     gcgttctacg agtaccactc ggctctcatg gagccctggg acggaccggc gtcggtgtgc      1080
     ttcaccgacg gcaccgtcat cggcgccgtg ctggaccgca acggtctgcg tccgtcgcgt      1140
     ctgtggatca ccgaagacgg cctcgtcgtc atggcgtcgg aggtcggcgt tctgccgatc      1200
     gatccgtcca ccgtggtccg caaggtccgc ctccagcccg gccgcatgtt cctcgtggac      1260
     accgcgcagg gccgggtcat cagcgacgac gaactcaagt ccgaactcgc tgccgagcac      1320
     ccgtaccagc agtggatcga cgaaggtctg atccacatgg acgacctgcc ggaccgcccg      1380
     tacacgtaca tgtcgcacga gcgcgtcgtg ctgcgtcagc agctcttcgg tttcaccagc      1440
     gaagaggtca acctgctggt caagccgatg gcactctccg gtgccgaggc actgggctcg      1500
     atgggtaccg acactccgat cgccgtgctc tcgtcacgtc cgcggatgct gttcgactac      1560
     ttctcgcagc tcttcgctca ggtcaccaac ccacctctcg acgcgattcg tgaagaggtt      1620
     gtcaccagcc tcggcgcgac catcggcccc gagggcgacc tgctgcaccc gaatgcggac      1680
     tcctgcaagc agattgcgct cccgcagccg atcctgcaca acgacgacct gtcgaagctc      1740
     gttcacgtca acgacgacgg cgaattcccg ggcttccgca gcgttgtgat ccgcggcctg      1800
     taccccgtca aggaaggcgg cgacggtatc cgtcgtgcgc tcgagggcat caagtaccag      1860
     gtctcgcagg caatcgaggg tggcgcacgc atcgtcgtgc tctcggaccg cgagtccacc      1920
     gaggattacg cgccgatccc gtcgctgctc ctcacctcag ccgtgcacca ccacctggtt      1980
     cgtgagaagt cgcgcaccaa ggtcggtctc atcgtcgagg ccggcgacgc ccgcgaggtg      2040
     caccacatgg cgctcctcat cggcttcggt gccgcagcgg tcaacccgta catggctttc      2100
     gagaccatcg acgagttcct gcagaacaag gaactcgagg gcctgaccct cgagaagggc      2160
     atcgcgaact acatcaaggc agccggcaag ggtgtcctga aggtgatgtc caagatgggc      2220
     atctcgacgc tcgcgtcgta caccggtgct cagctgttcc aggtcatcgg cctctcacag      2280
     gagctgacgg acgagtactt caccggtctg cagtcgcagc tcggtggcat cggcctcgac      2340
     cagatcgcag ccgacgtcga agcacgtcac cgcatcgcgt acctcgatcg ccccgaagag      2400
     cgcgctcacc gcgagctcga ggtcggcggc gagtaccagt ggcgtcgtga aggcgagtac      2460
     cacctgttca acccggacac ggtcttcaag ctccagcacg caactcgcac aggtcagtac      2520
     gaggtgttca aggagtacac gacaatggtc aacgaccagt cggagcgcct tgccgctctg      2580
     cgtggtctgt tcgacttcaa catcggcaag cggccgtcga tctcgatcga cgaggtcgag      2640
     ccggccagcg agatcgtcaa gcgtttctcg acgggtgcga tgagctacgg ctccatctcc      2700
     gccgaggctc acgagacact cgccatcgcg atgaaccgtc tgggcgcccg ctccaattcc      2760
     ggtgagggcg gcgaacatcc gtcgcgcttc acgccggacg agaacggcga tctgcgacgc      2820
     agtgccatca agcaggtcgc gtcgggacgc ttcggtgtca cctcgcacta cctgagcaac      2880
     tgcaccgaca tccagatcaa gatggcgcag ggagccaagc ccggtgaggg cggccagctt      2940
     ccggctcaca aggtgtaccc gtgggtggcc gaggttcggc actccacgcc tggcgtcggc      3000
     ctgatttcgc cgccgccgca ccacgacatc tactcgatcg aggatctcgc tcagctgatc      3060
     cacgacctga agaacgccaa cccgcaggcc cgcatccacg tgaagctggt ctccgaggtc      3120
     ggcgtcggaa ccgtcgcggc cggtgtctcc aaggcacatg ccgacgtcgt tctgatctcc      3180
     ggtcacgacg gtggcaccgg tgccaccccg cttacctccg tcaagcatgc gggcgcaccg      3240
     tgggagctcg gcctggccga gacccagcag acgttgctgc tcaacggtct tcgtgaccgc      3300
     atcgtcgtgc aggtcgacgg ccagctcaag acgggtcgcg acgtcgtcgt cgctgccctg      3360
     ctcggcggcg aggagttcgg tttcgccacc gcaccgctgg tggtctcggg ctgcatcatg      3420
     atgcgcgtct gccacctcga cacctgcccc gtcggtgtcg cgacgcagaa cccgttgctg      3480
     cgtcagcgtt tcagtggcaa gccggaattc gtcgagaact tcttcatgtt catcgccgaa      3540
     gaggttcgcg agcttctcgc cgaactcggt ttccgcacgc tgctcgaagc cgtcggccag      3600
     gtcgacatgc tggacaccac acgcgctctc gatcactgga agggaagcaa ggcaggcaat      3660
     ctcgacctgt cgccgatcct gacccaggtc gagtccgcgt tcatggacca ggacctccac      3720
     tgcaccggca cacaggatca cggtctcgac aaggcactcg atcagcagtt gatcgtttcg      3780
     gcccgcaacg cactcgacaa gggtgaggcg gtctcgttcg agtccgcgat caccaacgtc      3840
     aaccgcacgg tcggcaccat gctcggccac gaggtcacca aggcgttcgg tggagagggc      3900
     ttgcccgagg gcaccatcga catcacgttc accggttccg ccggtaacag cttcggtgct      3960
     ttcgtgccga gcggtatgac cctgcgcctg cacggcgacg ccaacgactt cgtcggcaag      4020
     ggcctctcgg gtggacgcat cgtcgtacgc ccgccgctcg atgcagcgga aggctttgtc      4080
     gccgaggaca acatcatcgg tggcaacgtc atcctgttcg gcgccaccag cggcgaggct      4140
     ctgcttcgcg gtgtcgtcgg cgaacgcttc gcagtccgta actccggcgc cactgccgtc      4200
     gtcgagggtg tgggcgatca tggttgcgag tacatgacgg gtggaaaggt ggtcatcctc      4260
     ggagccaccg gacgtaactt cggcgccggc atgtccggtg gcgtcgcgta catctacaac      4320
     cccgacaagg cattcgagaa gaacctcaac accgaactgg tggacctcga ggatctttcg      4380
     ggcgacgact tcacctggtt gaagagcgtc atcgaacgtc atcgcgacga aaccggctcc      4440
     gaggttgcca cgcgcatcct cggcgactgg tcgcagcagg tgggtcactt cgcaaaggtg      4500
     atgccccgcg actacaagaa ggttcttttg gccatcgcgg ccgcagagaa ggatggcaag      4560
     aacgtggacg aggcagttat ggaggcagct cgtgggtga                             4599
//

If you have problems or comments...

PBIL Back to PBIL home page