(data stored in ACNUC1104 zone)

EMBL: AP008957.HOLB

AP008957.HOLB        Location/Qualifiers
FT   CDS_pept        568857..570086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="RER_05140"
FT                   /product="putative DNA polymerase III delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31222"
FT                   /db_xref="GOA:C0ZNH0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH0"
FT                   /protein_id="BAH31222.1"
FT                   /translation="MSTEVAERGVFGRLVGQHDVEQSLRDAALSARGDSSGSEMTHAWL
FT                   FTGPPGSGRSVAALCFAAALQCTSDGAPGCGECHACTTTMGGTHGDVRRIIPDGLSISV
FT                   KGMREIVNIASRRPTTGRWQVIVVEDADRLTEGAANALLKVVEEPPDRTVILLCAPTTD
FT                   PEDMSVTLRSRCRHMPLVTPSVESIAQVLIDRDGLDPERARIAASISGGHVGRARRLAT
FT                   DESARDERQRSLRLAADAIGASTAYKAAENLVKSIEADTKAFYAELKEQELEELKVSLG
FT                   GGGTGKGTAGTLRGSAGLIKDLEARQKSRDTRARRDLLDRTLIDLAGMYRDALSYSLGS
FT                   TSTATHPDMARQAAELAARTSPEGLLKCIEAVLECREAVDFNVKLQWALDAMVASIGAA
FT                   FRPPFSRSGG"
     atgagtactg aagtggccga acgaggtgtg ttcggtcggc tggtgggtca gcacgacgtc        60
     gagcagagcc tgcgtgatgc tgcactgtcg gctcgtggcg attccagcgg ctcggagatg       120
     acccacgcgt ggctcttcac cgggccaccc ggctctggtc gttcggttgc tgctctctgc       180
     ttcgccgcag ccctgcaatg cacctccgac ggtgcaccag ggtgcggtga gtgtcatgcg       240
     tgtacgacga cgatgggtgg aacccacggt gacgtacgac ggatcatccc cgacggcctg       300
     agcatcagcg tcaaaggcat gcgcgagata gtcaacatcg cttcgcgtcg gccgacgacg       360
     gggcggtggc aggtcatcgt ggtcgaggat gccgatcgtt tgaccgaagg cgcagccaac       420
     gccctgctga aggttgtcga ggagccacct gaccgcacgg tcatcctgct ctgcgcgccg       480
     acgaccgatc cggaagacat gtctgtcacc ctccgttcgc ggtgtaggca catgccgttg       540
     gtgacgccgt ccgtcgaatc gatcgctcag gtactgatcg accgcgacgg gctggatccg       600
     gagcgggcga gaatcgccgc atcgatcagc ggcggacatg tcggtcgggc gcggcgcctc       660
     gccaccgatg agagcgcgcg ggacgagcgt cagcgttcgc ttcggctggc cgcagacgcg       720
     atcggtgctt cgacggcgta caaggccgca gagaacttgg tgaagtcgat cgaggctgac       780
     accaaggcgt tctacgccga actcaaggaa caggaactcg aggagctcaa ggtctccttg       840
     ggtggcggtg gaaccggcaa gggaacagcc gggactctgc gcggatcggc tggtctgatc       900
     aaggacctcg aagcacgcca gaaatcgcgc gacacccggg cccgccgcga tcttctcgac       960
     cggacgctga tcgacctggc cggcatgtac cgggacgcgc tttcctattc gctggggtcg      1020
     acgtcgacgg cgacccatcc cgacatggct cggcaggccg ccgagttggc tgcacgaact      1080
     tccccggagg ggttgctcaa gtgcatcgaa gcggtgctcg aatgccgcga ggccgtcgac      1140
     ttcaacgtca agttgcagtg ggcgctcgat gcgatggttg cctccatcgg agccgctttc      1200
     cgacccccgt tttcgcgatc cgggggttga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page