(data stored in ACNUC1104 zone)

EMBL: AP008957.MCE1B

AP008957.MCE1B       Location/Qualifiers
FT   CDS_pept        complement(755463..756473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1B"
FT                   /locus_tag="RER_06760"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31384"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ6"
FT                   /protein_id="BAH31384.1"
FT                   /translation="MSVKKSLIRFGLFAALSILATVVVVSTLINPVSGSSSQYRAVFVN
FT                   ASGLVTGSDVQIAGVRVGRVDSVELVNNQAVVGFELESTQRIPTDGRAVVRYADLLGAR
FT                   TISIEPGQGELVAGNYLSPGATIPVEQTQPAIDLTDILGGFRPLFDALDPAEVNELAAQ
FT                   VVQVFQGQGSTIESLLERTVAVTENLTSRDAILDQLLTNLDRVLTVTTTNRPNFVEMIN
FT                   TLDTLVGGLAQDRQQISAAVDSAGALTSSLQDLVTRVEPDLAGALTSIDQSASVVVDNR
FT                   ESLATGITAFDQLFTQLGIAMSYGSWANIYICNFRLSALDQSVTLGGPERSAVCR"
     atgagcgtga agaaatctct gatcaggttc ggactgtttg ccgcgctgtc gattctcgcc        60
     accgtggtcg tggtgagcac tctgatcaac ccagtctccg ggtctagttc gcagtaccgg       120
     gccgtcttcg tcaatgcctc cggcctggtc accggcagcg atgttcagat cgccggggtg       180
     cgagtagggc gcgtcgacag cgtcgagttg gttaacaacc aagccgtcgt cggcttcgaa       240
     ctcgaatcta cacaacgtat tccgaccgac ggtcgggctg tggtgaggta tgcagatctg       300
     ctgggggcac ggacgatctc gatcgaaccc ggacagggcg aactcgtagc cggcaactac       360
     ctctcccccg gagccacaat tcccgtggaa cagactcagc cggcgatcga cctcaccgac       420
     atcctcggcg gtttccgtcc cctgttcgac gcacttgacc ccgcagaagt caacgagctt       480
     gccgcacaag tcgtccaggt attccaagga caaggttcca ccatcgaaag cctgctggag       540
     cgcacagttg ccgtcaccga gaacttgacg tcccgagacg cgatcttgga ccaactactg       600
     accaacctcg accgggtact caccgtcacg acgacgaatc gacccaactt cgtcgagatg       660
     atcaacacgc tcgacacgct ggtaggcggt ttggcacagg atcgccaaca gatctcggcc       720
     gcagttgatt ccgcaggtgc cctgacttct tcccttcagg acttggtgac gcgcgtggaa       780
     ccggacttgg ctggcgcgct gacttcgatc gatcagtcgg ccagcgtcgt cgtcgacaat       840
     cgtgagtcgc tggcgaccgg tatcaccgct ttcgatcaac tgttcaccca attgggaatc       900
     gcaatgagct acggcagttg ggcgaacatc tacatctgta acttccggct cagcgcgctg       960
     gaccaatcgg tgactctcgg cggccccgag cgttcggcgg tgtgccgatg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page