(data stored in ACNUC1104 zone)

EMBL: AP008957.MCE1C

AP008957.MCE1C       Location/Qualifiers
FT   CDS_pept        complement(754474..755466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1C"
FT                   /locus_tag="RER_06750"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31383"
FT                   /db_xref="GOA:C0ZPQ5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ5"
FT                   /protein_id="BAH31383.1"
FT                   /translation="MNWLTVKNPVRNGMICILVGVCVVLAALVVPQLILKVKTNEYNAV
FT                   FANATGLTQDDPVNVAGVPSGVVTSLAVSGNSVEVTFRLDDGVTLGENSRADIKISTLL
FT                   GRRSLDITPNGSRSLPGGSTIPIENTSVPFTLDDLGRGAQSTSENLDLQQLRNMLTVVS
FT                   DNSPDDPELIRRSLEGIDALSGVVNDNDVALRSLLTGAQQTTATLIEQKDTLETLLGNA
FT                   DLVMATIADRRDVLNALVQDLNQLSTTLAQFLGDNQALVDSVMGDIHEVTGVLSENEQS
FT                   LTTLLDNFAPSVRYVTNATGNGNWLDLNSPSTLIPDNWLCVVGLVQGCR"
     atgaactggc tcaccgtcaa gaacccggtc cgcaacggaa tgatctgcat tctcgtcgga        60
     gtctgtgtcg ttctggccgc actcgttgtc cctcaattga tcttgaaggt caagaccaac       120
     gagtacaacg ccgtgtttgc caacgccacc ggattgacgc aggacgatcc ggtcaacgtc       180
     gcgggagtcc cgagcggggt ggtcacctcg ttggcggtca gcggcaactc cgttgaagtc       240
     accttccgac tcgacgacgg cgtcactctc ggcgaaaact cgcgcgcgga catcaagatc       300
     tcgactctgc tcggccgacg ctcgctcgac atcactccga acggatcgcg ctcgttaccc       360
     ggaggttcga ccattcccat cgagaacacg agtgttccgt tcaccctcga cgatctcgga       420
     cgaggagcac aatccacttc ggaaaacctt gatctgcaac aactgcgaaa catgctgacc       480
     gtggtgtccg acaactcacc ggacgatccc gagctcattc gccgctcgct cgagggaatc       540
     gacgcactct ccggagtagt caacgacaac gacgttgcgc tccgttccct tctcaccgga       600
     gcgcagcaga cgaccgcaac actgatcgag cagaaggaca ctctggaaac ccttctggga       660
     aatgcggacc tggtgatggc cacgatcgcc gaccggcgag atgtgctgaa tgcgcttgta       720
     caagacctca atcagttgag caccacactt gcccagttcc tgggtgacaa ccaggcattg       780
     gtcgactcgg tcatgggaga catccacgag gtgacgggag ttctttccga gaacgaacaa       840
     tcactgacca cgttgctcga caacttcgcc cccagcgttc ggtacgtcac caatgcgacc       900
     ggtaacggca actggctcga cctcaactca ccctccaccc tcatcccgga caactggttg       960
     tgcgtcgtcg ggctcgttca ggggtgtcga tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page