(data stored in ACNUC1104 zone)

EMBL: AP008957.MCE1D

AP008957.MCE1D       Location/Qualifiers
FT   CDS_pept        complement(753398..754477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1D"
FT                   /locus_tag="RER_06740"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31382"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ4"
FT                   /protein_id="BAH31382.1"
FT                   /translation="MTTTVKKLAVLAAIMICAIGAVLFVTRDEHQLTLTAEFTSTDAIF
FT                   TGNTVTILGVPSGRVESVTPEGSRVRVAMSLPSGTRIPADAQAWVLSPSVISDRTIELG
FT                   PGYEDGEFLADGAVIPLERTHSPLTWDQLTASVNELTVALGPGADGGGIGDLIGEGAHA
FT                   LDGNGQAFNDAVRSISQASSVLAGASPDISELVKNLNTLVQLIADNQTKVDSLSNSVTV
FT                   TARAFSTQREDISGALDSLTTLLGQVSALLAEHGEAVTADLGVLAQLAGAVATKQDQLR
FT                   EIIETAPTGFENVANLVTEEGRARARLNVATDLSQFDTTRELCEKMPIPLCTGPGIVNP
FT                   IEFPSAGSSDLARILGGGN"
     atgaccacga ccgtcaagaa gctcgccgtg ctggcagcga taatgatctg cgcgatcggt        60
     gcggtcctgt tcgtcacgcg tgacgaacac caactcactc tcactgccga attcacctcg       120
     accgacgcca tcttcaccgg caacacggtg actattctgg gagttcccag cgggagggtc       180
     gagagcgtca cgccggaagg gtcccgggta cgagtggcga tgagcctgcc atccggaaca       240
     cgcataccgg ccgacgctca ggcctgggtc ctgtctcctt cggtcatcag cgaccgcacg       300
     atcgaactcg gccccggcta cgaggacggt gagttcctcg cggacggcgc agtgatccct       360
     ctcgaacgaa ctcactcccc tctgacatgg gaccagctca ccgcatcggt gaacgaactg       420
     acggtggcgc tcggccctgg cgcggacggc ggtgggatcg gtgacctcat cggagaaggc       480
     gcccacgcgt tggacggcaa cgggcaagca ttcaacgatg ccgttcggtc catctcacag       540
     gctagttcgg tactggcggg tgcaagtccc gacatctccg aactcgtgaa gaacctgaac       600
     accctcgtgc agttgatcgc ggacaaccag accaaggtcg actcgctgtc gaattcggtg       660
     acagtcaccg cccgcgcgtt cagtacccag cgagaagaca tcagcggggc gctcgattcc       720
     ctgaccacgt tgctcggaca ggtctcagcg ctactcgccg aacacggcga ggcggtcacc       780
     gccgatctgg gtgtgctcgc acagttggcc ggtgcagtcg cgaccaaaca ggaccaactg       840
     cgcgagatca tcgaaacggc accaacggga ttcgagaacg tcgccaacct cgtcaccgaa       900
     gaaggtcgag ccagagcgcg actgaacgtc gccaccgatc tctcacagtt cgacacgacg       960
     cgagaactgt gcgagaagat gccgattccg ctgtgcaccg ggcctgggat cgtcaatccc      1020
     atcgaatttc cttcggcagg cagctccgac ctggcacgca tcctcggtgg gggcaactga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page