(data stored in ACNUC1104 zone)

EMBL: AP008957.MCE1F

AP008957.MCE1F       Location/Qualifiers
FT   CDS_pept        complement(751090..752328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1F"
FT                   /locus_tag="RER_06720"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31380"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ2"
FT                   /protein_id="BAH31380.1"
FT                   /translation="MKNRTVYFEIVAFLLIAVVSTTYVLRQVGAGDPFTGTFSVTVELE
FT                   NAAGIAPGSEVAYRGVTVGDVESVEVDSAQDLVVMTLSIAADKQIPNDSHVAISQDTAV
FT                   PVLKVQLSSQTDGGPYLVEGSVVPTERTSIPVALGTVIANFNAAADTVDPADLRTLSHE
FT                   LGEGLNGLGPDLQALVDNFDVLARTVQADQPRVNTLVENSRSLFTANEENVDALPEVAL
FT                   TLRQLTDQVRNSDPQLRTLLDRSPSVLDNQILPLIEQSREPFSLLLANSLVSTQIVTAR
FT                   MPAVDALLVVVPKGFEKFGSIVKDGRAQLDLITALGPVCIYDTPRRSVQDTSPTTLDKN
FT                   QHCADQSGRIQNRGSQNVPTGTGTIDGVAEYDPALGTVAAGDGTSIRLGLNGGQYTVLG
FT                   DNSFAALLVQGTQ"
     atgaagaacc gaaccgtcta tttcgagatc gtcgcctttc tcctcatcgc ggtggtcagc        60
     acgacgtatg tgctccgaca agtaggtgct ggagatccct tcaccggaac gttctcggtc       120
     accgtcgaat tggagaacgc ggccggaatc gctccgggtt cggaagtggc ctatcgcgga       180
     gtcaccgtcg gcgacgtcga gtcggtggag gtggactctg cccaggacct cgtcgtgatg       240
     acgttgagca tcgccgccga caaacagatc cccaacgatt cgcatgtggc catcagccag       300
     gacaccgccg ttcccgtatt gaaagttcag ttgtcctcgc agaccgacgg cggcccgtat       360
     ctggttgaag gttcggttgt tccgactgag cgcacttcga tcccggtcgc gttgggaacc       420
     gtgattgcga atttcaacgc tgctgccgac accgtcgatc cggcagatct gcgtaccctc       480
     tcgcacgaac tcggtgaggg attgaacgga ttgggtccgg atctgcaggc gctcgtcgac       540
     aacttcgacg tgctcgcgcg cactgtccaa gccgatcaac cgcgtgtcaa cacactcgtc       600
     gagaactcgc gctcactgtt cactgcgaac gaggaaaatg ttgacgctct tcccgaagtt       660
     gcactcacac ttcgccaatt gacagatcag gtacgaaact ccgatccgca actgcgcaca       720
     ctcctcgatc gaagcccgag tgttctcgac aatcagatac tgcctctcat cgaacagagt       780
     cgtgagccgt tcagtctgct gttggccaat tctctcgtct ccactcagat cgtcactgca       840
     cggatgcctg ccgtcgatgc cttgttggtg gtggtgccca aaggattcga gaagttcgga       900
     agtatcgtca aagacggacg ggcacagctt gatctgatca cagcactcgg cccggtctgt       960
     atctacgaca cgccccggcg atcggtacag gacacctcac cgaccacgct cgacaagaac      1020
     caacactgcg cggaccagtc gggccggatc cagaatcgcg gttcgcagaa cgtccccacc      1080
     ggaactggaa cgatcgacgg ggttgccgaa tacgatcctg ctctcggcac agttgcggcc      1140
     ggtgacggaa cgtcgattcg tctgggcctc aacggtggtc agtacaccgt tctcggtgac      1200
     aactcgtttg ccgcactact agtacaagga acgcaatga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page