(data stored in ACNUC1104 zone)

EMBL: AP008957.MGTC

AP008957.MGTC        Location/Qualifiers
FT   CDS_pept        666766..667470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtC"
FT                   /locus_tag="RER_05890"
FT                   /product="putative membrane protein MgtC"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31297"
FT                   /db_xref="GOA:C0ZNP5"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP5"
FT                   /protein_id="BAH31297.1"
FT                   /translation="MEIHVILVRIALGLVLGAAVGIERQWRARMAGLRTNALVSLGATL
FT                   FVIMGAYGFQGPDADPTRVAAQIVSGIGFLGAGVIMKQGASVTGLNTAATLWATAAVGA
FT                   LAGGGMYWVAVFGAGAIMLANTLLRPLGRMMDHQPARTGREEPPADYTFEVTCHGDAEA
FT                   HIRGLTVQSISRPEFQLRSVQSFDIPDSDRVRVVAELAAAERDDGLLESAVSRLSLEPL
FT                   VTHVRWEVEPSK"
     gtggaaatcc acgtcatcct tgtgcggata gcgctcggac tcgtcctcgg cgctgccgtc        60
     gggatcgaaa ggcaatggcg cgcaaggatg gcgggtctgc gaaccaacgc gttggtgagc       120
     ttgggtgcga cgctcttcgt catcatgggc gcgtacgggt ttcaggggcc ggacgctgat       180
     ccgacgcgcg tcgcagcgca gatcgtctcg gggatcggct tcctcggtgc cggggtgatc       240
     atgaagcagg gagcctcggt caccggcctg aacaccgccg caaccttgtg ggccacggcc       300
     gccgtcggtg cgctggcagg cggcggaatg tactgggttg cggtgttcgg tgccggtgca       360
     atcatgttgg cgaatacgtt gttgaggccg ttgggccgga tgatggatca ccagcctgcc       420
     cgcaccgggc gcgaggaacc gccggctgac tacaccttcg aggtgacctg ccacggtgac       480
     gccgaagctc acatcagagg gcttaccgtg cagtccattt cgaggccgga gttccagctc       540
     cggtcagtgc agtccttcga catcccggac agcgaccgcg tacgagtggt cgcggaattg       600
     gccgcagcgg agcgtgacga cggactcctg gaatccgccg tcagccggct tagcctggaa       660
     ccgttggtaa ctcacgttcg ctgggaggtg gagccgtcga agtag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page