(data stored in ACNUC1104 zone)

EMBL: AP008957.NTH

AP008957.NTH         Location/Qualifiers
FT   CDS_pept        533264..534049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="RER_04820"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="protein synonym:DNA-(apurinic or apyrimidinic site)
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31190"
FT                   /db_xref="GOA:C0ZND8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND8"
FT                   /protein_id="BAH31190.1"
FT                   /translation="MQTTPTGSSEQRKKPRSGGARKEESHLGLVRRARRMNRELAVAFP
FT                   HVYCELDFTTPLELAVATILSAQCTDVRVNMVTPALFARYPDAKAYAEADRTELEEYIR
FT                   STGFYRNKTTSLIGLGQALLERHDGQVPNKLEDLVKLPGIGRKTANVVLGNAFDIPGIT
FT                   VDTHFGRLVRRWKWTEEEDAVKVEHAVGALIERKEWTLLSHRVIFHGRRVCHARKPACG
FT                   VCVLAKDCPSYGLGPTDKTEAAALVKGPETDHLLALAGL"
     gtgcagacca ccccgacagg cagttcagag cagcggaaga aaccgcgttc ggggggtgcg        60
     cggaaggaag aatcacacct cggattggta cgccgggcgc gtcggatgaa tcgcgagctc       120
     gctgtggctt tcccgcacgt gtattgcgaa ctcgacttca cgactccgtt ggaactggca       180
     gtggcgacaa tcctgtcggc gcaatgcact gacgtccgcg tcaacatggt cacgccggcg       240
     ctcttcgccc gctatcccga cgcgaaggca tacgcggaag ccgatcggac cgaactcgag       300
     gagtacatcc gctccaccgg cttctaccgg aacaagacga cgtcgttgat cggactcggt       360
     caggcgctac tcgaacgcca cgacggtcag gtcccgaaca agctcgaaga tctggtgaaa       420
     ctcccaggca tcggacgcaa gaccgcgaac gtcgtgctgg gcaatgcctt cgacatcccg       480
     ggaatcaccg tcgacaccca cttcggtcgg ctcgtgcgtc ggtggaagtg gaccgaggaa       540
     gaagatgccg tcaaggtgga acacgccgtc ggggcactga tcgaacgtaa ggaatggaca       600
     ctgctctcgc accgcgtgat ctttcacggc cgacgggtct gccacgcgcg caagcccgcg       660
     tgcggggtgt gcgttctcgc caaggactgc ccgtcgtacg gactcggccc gaccgacaaa       720
     accgaggccg cggccctggt gaaaggcccc gagaccgacc atctgctcgc cctggcaggg       780
     ttgtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page