(data stored in ACNUC1104 zone)

EMBL: AP008957.PANC

AP008957.PANC        Location/Qualifiers
FT   CDS_pept        713236..714177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="RER_06330"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="protein synonym:pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31341"
FT                   /db_xref="GOA:C0ZPL3"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL3"
FT                   /protein_id="BAH31341.1"
FT                   /translation="MTVVSDLQGGYKRGELTVHHDPDRLRRVSRALRGVGRQVALVPTM
FT                   GALHAGHIELVRQAKVTGAVVIVSIFVNPLQFGAGEDLDAYPRTLDADLDLLRAEGVEL
FT                   VFAPSAKTMYPRGQRTTIVPGPLGSELEGGARPTHFAGMLTVVAKLLQIAAPNHAYFGE
FT                   KDYQQLTLIRQMVWDLNFDVQIIGVPTVREFDGLALSSRNRYLDEGQRAAAVALSAALI
FT                   AGAHAASGGAEAILETARAVLAAVPEIEVDYLEVRGVDLGPAPERGDGRLLVAAKLGTT
FT                   RLIDNVGVAVGTGFLERDTDPSADAIDDLLSH"
     gtgaccgtcg tgagtgatct gcagggcgga tacaagcgcg gcgaactgac ggtgcaccac        60
     gatccggaca ggcttcggcg cgtctcgcgg gcactgcgag gtgtcgggcg tcaggtggcg       120
     ctcgttccga cgatgggtgc gttgcatgcc ggccacatcg aattggttcg tcaggccaag       180
     gtcaccggcg ccgtcgtgat cgtttccatc ttcgtgaacc cgctccagtt cggtgcgggc       240
     gaagacctgg acgcgtaccc gcgcactctc gatgcggatc tcgacctgct tcgcgccgag       300
     ggcgtcgaat tggtgttcgc gccgagcgcc aagacgatgt acccgcgggg ccagcgcacc       360
     accatcgtgc cgggcccgtt gggtagcgaa ctcgaaggcg gagcgcgccc cactcacttc       420
     gccggaatgc tgacggttgt ggcgaagctg ctgcagatcg cggcacccaa tcacgcctac       480
     ttcggtgaga aggactacca gcagctgacg ctcatccgtc agatggtgtg ggatctcaat       540
     ttcgacgtac agatcatcgg agttccgacg gtccgcgagt tcgacggcct cgcgttgtcc       600
     tctcgcaatc gctacctcga cgagggccag cgcgccgcag cggtcgcgct gtccgctgct       660
     ctgatcgccg gtgcacacgc ggcgtccggg ggagcggaag caattctgga aaccgcacgc       720
     gctgttctgg cagctgttcc ggaaatcgag gtcgactacc tcgaggttcg gggcgtcgat       780
     ctgggccccg cgcccgagag aggtgacggc cgactgttag tggccgccaa gctcggaacc       840
     acccgtttga tcgacaacgt cggtgtcgcg gtgggaaccg ggttcctcga gcgtgacacc       900
     gacccatccg ccgacgccat cgacgacctg ctgtctcact ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page