(data stored in ACNUC1104 zone)

EMBL: AP008957.PE102

AP008957.PE102       Location/Qualifiers
FT   CDS_pept        121221..121568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30810"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC0"
FT                   /protein_id="BAH30810.1"
FT                   /translation="MPVMAVHRDGSIVFANPSFADMLGYPKKAVSALRLQDILYDKDAD
FT                   DVSAEQAHRELSSEPGSVKEFVHSDSTLVRATVSQSLLRRDDDTITLAVLHDLTERLWN
FT                   NPRHIDDKPTK"
     gtgccggtca tggccgttca ccgcgacggc agcatcgttt ttgccaatcc gtccttcgct        60
     gacatgctgg gatatcccaa gaaggccgtc tcggcgttgc gtttgcagga cattctctac       120
     gacaaggatg ccgacgacgt gagtgccgag caggctcatc gtgaactgag ttccgagccg       180
     ggctcggtca aggagttcgt gcactcggac agcacattgg tgcgcgcgac ggtcagtcag       240
     tctctgctcc gacgggacga cgacacgatc accctcgccg tccttcacga tctgacggaa       300
     cgcctgtgga acaacccacg gcacatcgac gacaagccca ccaagtag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page