(data stored in ACNUC1104 zone)

EMBL: AP008957.PE105

AP008957.PE105       Location/Qualifiers
FT   CDS_pept        complement(123171..124463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30813"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC3"
FT                   /protein_id="BAH30813.1"
FT                   /translation="MRSLLVDRRTGIIRELVDAFVPQHFPPEFKLIHSYASDSARFSPW
FT                   SSDSAGAGYCFDLGDRARPTAAAIGEAVERYCGNIVAKPIVRGSADALIGASIDLSQLA
FT                   RFDAAQYAQPQFPFVEPTDDLELDWTRGVDLITGADTWVPAELVWGSYPHFVARTGPAI
FT                   SPVAQAGLAAGPTTEFAIRNALREIVERDAMTLSWTGRRGVRIVTGIPEVLRRLGNHGS
FT                   LSTRWLSFDSDFGIPVLGALVHDRLTGYSTMGTACHEEARTAAFKSLGEALQLQLLSAD
FT                   YDNPESGIGRAAASPTSPLAPWRADRSYAGAYRSDFADVMDYGCHLQLHLDPEIQARFE
FT                   SELAGAVVGEVDLDSLTSPIDTESALTGSGFRPAWVDLTTTDVLSAGLRVVRVVVPGCL
FT                   TNAAAGLPFLGSPRLVDGLAGRPPRTIPLPH"
     atgaggtctt tgctcgtcga ccgccgaact gggatcattc gagagttggt cgacgccttt        60
     gttccccagc actttccgcc ggagttcaag ctgattcact cgtatgcctc cgactcggca       120
     cgcttctcac cctggtccag cgactcggcg ggtgccggat actgcttcga tctgggtgac       180
     cgtgcgcggc ctaccgctgc cgcgataggt gaagcggtgg aacgatattg cgggaacatc       240
     gtcgccaaac cgatcgtccg cgggtcggcc gatgcattga tcggagcaag catcgacctg       300
     tcacaactcg cgcgtttcga cgccgcccag tacgcgcagc cacagttccc gttcgtcgaa       360
     ccaaccgacg atctcgagtt ggactggact cgcggagtcg acctgatcac gggtgcggat       420
     acctgggtac cggccgaact cgtctggggt tcgtatcctc atttcgtcgc ccggacgggt       480
     ccggcgatct ctccagtagc gcaggcgggt ctcgccgccg gtcccacgac ggaattcgcg       540
     atacggaatg cattgcgcga gatagtcgag cgcgacgcga tgacgctttc ctggaccgga       600
     agacgcggcg ttcggatagt caccggcatc cccgaggtgc ttcgccgcct gggcaatcac       660
     ggcagcctct cgaccaggtg gttgtcattc gacagcgatt tcggcatccc ggtgctcggc       720
     gccctcgtcc acgaccgact caccggatac tcgaccatgg gtaccgcctg ccacgaagaa       780
     gcgcggacgg ctgctttcaa gtcgctcggc gaagcgcttc agctgcaact gctttccgcc       840
     gactacgaca acccggagag cggcatcggt cgagccgcgg cctccccgac cagcccgctt       900
     gcgccttggc gagctgaccg aagctatgca ggcgcctacc gatcggactt tgccgacgtg       960
     atggactacg ggtgccactt gcagctccac ctggacccgg agatccaagc acgattcgag      1020
     agtgagctgg caggtgccgt cgtcggcgag gtggacctcg actctctgac gtcacccatc      1080
     gacaccgaaa gcgcactgac aggctcgggt ttcaggccgg catgggtcga cctcaccact      1140
     actgatgttc tcagcgccgg cctgcgcgtc gtccgcgtcg tcgttcccgg ttgtctcacc      1200
     aatgcggccg ccggattgcc gtttctcggc tcgccccgac tagtcgacgg ccttgccgga      1260
     cgtccgcctc gtaccatccc attgccgcac tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page