(data stored in ACNUC1104 zone)

EMBL: AP008957.PE108

AP008957.PE108       Location/Qualifiers
FT   CDS_pept        complement(127217..128053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30816"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC6"
FT                   /protein_id="BAH30816.1"
FT                   /translation="MRAPTRRSVYALADGHHPYPTPDGVWHYLTPDENAVTIGAPAEDL
FT                   AELDNFLRRSGSVLGPGAIEIADALVSRGVLAVPGQVPEIPAPQRVLMDGVGPVADACI
FT                   ALLSKALPDLEVVSTTAPIEDDVASSDLVLSVADAPPHDAWSELDTWCRHSRTPWQRVH
FT                   KELGEICIGPFFDGIDSASYRDVCGRRLAASRVPDHLLALWNHLADSERRPLGLSPTAA
FT                   AMVSALACSDVVAGAHGAPQSHLHHQIRMNPRTLMMTRHPVLPLPGGVLEPSPTLR"
     gtgcgggcac cgacaaggag atccgtgtac gccctcgccg acggacacca cccgtatccg        60
     acaccggacg gtgtttggca ttacctgaca ccggatgaga acgcggtcac gatcggcgcg       120
     ccggccgaag atctcgcgga actcgacaac tttctcaggc gctctggttc ggtgctcggc       180
     ccgggagcga tcgagatcgc cgacgctctc gtctctcgcg gcgtgctggc tgttccaggt       240
     caagtgccag agattccggc cccacagcgt gtgctgatgg acggggtcgg acccgttgcc       300
     gatgcttgca tcgctctgct ctccaaggct cttccggacc tcgaggtcgt atccaccact       360
     gcgccaatcg aagacgacgt tgcgtcttcg gacctcgtac tgtcggttgc cgacgctcct       420
     cctcacgacg cgtggtcgga actcgatacc tggtgccgcc acagccgaac tccgtggcaa       480
     cgcgtccaca aagagctggg tgagatctgc atcggtccct tcttcgacgg catcgacagc       540
     gcgagctacc gggacgtctg cggtcggcgg ctagccgcgt cacgcgtacc ggatcacctg       600
     ctggcgctgt ggaaccacct cgccgacagc gaacgtcgtc cgcttggact ttcacccacc       660
     gcagccgcaa tggtcagtgc acttgcatgt tcggacgtcg tggctggtgc ccatggcgca       720
     ccgcaatcac accttcacca ccagatccgg atgaatccac gaaccctcat gatgactcgc       780
     catcccgtgc taccactgcc tggcggcgtt ctcgaacctt cgccgacgct ccggtga          837
//

If you have problems or comments...

PBIL Back to PBIL home page