(data stored in ACNUC1104 zone)

EMBL: AP008957.PE109

AP008957.PE109       Location/Qualifiers
FT   CDS_pept        complement(128124..128447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30817"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC7"
FT                   /protein_id="BAH30817.1"
FT                   /translation="MVALRRIPSSRSRSCMHSLVPVALRGDLSYGGIVMEMVSITEGMT
FT                   MSNISFDSVSNSAPANALQGVGTNALVDNPFTFEPVAEATSAHALQGVGTNALVDNPFS
FT                   FQS"
     gtggttgcgc ttcggcggat cccgtcgtcg aggtctcgct catgtatgca ctctcttgta        60
     cctgttgctc tccgtggcga tctttcgtac ggtggcatcg taatggaaat ggtttccatt       120
     acggaaggga tgacaatgag caacatttcg ttcgacagcg tctccaactc ggctccggcc       180
     aatgcactcc agggcgtcgg caccaacgcc ctcgtcgaca acccgttcac cttcgagccg       240
     gttgccgagg cgacgtccgc acacgctctg cagggtgtgg gcaccaacgc cctcgtcgac       300
     aacccgttca gcttccagag ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page