(data stored in ACNUC1104 zone)

EMBL: AP008957.PE115

AP008957.PE115       Location/Qualifiers
FT   CDS_pept        complement(133277..133570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30823"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD3"
FT                   /protein_id="BAH30823.1"
FT                   /translation="MSFLRRAGRVAVASSIHGNVQRRQRTRWAAEDQARAAQVQPVPPI
FT                   PDLPPLPPQAAPAESEMSMDAKLEQLTKLGELKNAGVLTEAEFETQKARILG"
     atgagtttct tgaggcgagc cggccgggta gccgtcgcaa gctccattca cggcaatgtt        60
     cagcgccgtc agcggacccg ttgggccgcc gaagatcagg cccgcgcagc gcaggtccag       120
     ccggtgccgc cgattcccga tctaccgccc ctcccgccgc aggcagctcc ggcagaatcg       180
     gaaatgtcga tggacgctaa gctcgaacag ctcaccaagc tgggcgaact caagaatgcc       240
     ggcgtattga cggaggccga gttcgagacc cagaaggcgc gcatcctcgg ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page