(data stored in ACNUC1104 zone)

EMBL: AP008957.PE116

AP008957.PE116       Location/Qualifiers
FT   CDS_pept        complement(133567..134019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30824"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD4"
FT                   /protein_id="BAH30824.1"
FT                   /translation="MSNQDQFGPIEYVAVEFPGSAPTSAGFEQLLALVDSGVIRILDLE
FT                   FVTKAADGSVSVVPASTFELVDFDLAQFDGAASGLLDVGDIAAVGEELAAGSVAAVLVY
FT                   EELAILPVIEAWTRSGAKVVTEGHLSLDELAAALDNTAPDTTEKDA"
     atgtccaacc aagaccaatt cggtccgatc gaatacgttg ccgtcgagtt tcccggcagt        60
     gcaccgacct ccgcgggatt cgagcagctg ctcgctctcg tggactccgg agtgatccgc       120
     atcctcgacc tcgagttcgt caccaaagcc gccgacggat cggtatccgt cgtaccggcg       180
     tccaccttcg aactcgtaga tttcgatctg gcgcagttcg acggcgctgc ctccggactg       240
     ctcgacgtcg gcgacatcgc tgccgttggt gaagagttgg ccgccggaag tgttgccgcc       300
     gtactcgtct acgaggagct ggccatactg ccggtcatcg aggcctggac ccgcagcggc       360
     gcaaaggttg tcaccgaagg tcacctgagc ttggacgaac tggctgctgc actggacaac       420
     accgcaccgg ataccacgga gaaggacgca tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page