(data stored in ACNUC1104 zone)

EMBL: AP008957.PE120

AP008957.PE120       Location/Qualifiers
FT   CDS_pept        complement(137593..139155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01200"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30828"
FT                   /db_xref="GOA:C0ZLD8"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD8"
FT                   /protein_id="BAH30828.1"
FT                   /translation="MSTETDTGSAPTPAKKKFEFPGAVTMLAIVTVLVWVAALFIPAGR
FT                   FGVDVDGSPVPGSFETVTSPLSFWERIQQLILSPVNGLYGVQDSITGFVDTDNIGRLFG
FT                   SVGVVLFIMALGAFISVSFATRSLETAVSQLATKLSDKGWLLITVIMVLFSLLGSTMGF
FT                   SVETFGFYALLIPLMTALGYDRMVAATMIILGALVGNMASTVNPFSIGVASGEAGVSIG
FT                   DGIVLRVILWIVLTAVAVVFVLRYAAKVKKDPSKSLVGFDIEDDEDEEPAEPVDIDGKL
FT                   TGTQKLVLLITGLTFGLMIFSVIPWSSIFGATTGPAEYDAYHVTATEPYWFELNWWFPQ
FT                   LAMLFILAAVLVGIVAKMGEKKIVSLITRGAGDMVGPAIVILLARGVSVIMTNTETLDT
FT                   ILNAMEQLVSGASAGVFAILVMLVNIPLAFLIPSSSGHATLAMPLLAPLGDFAGVSRAL
FT                   VITAFQMGHGLMLMVAPTNVVVVGGLAMAKVGYDKFLRFVWPLLLINFVIVVVVIGAAA
FT                   VFE"
     atgagcaccg agaccgacac gggatccgca cctactccgg ccaagaagaa gttcgagttt        60
     cccggtgcgg tcacgatgct cgcgatcgtc accgtcctgg tctgggttgc agcactgttc       120
     attccggccg gacgcttcgg cgtcgacgtg gacggctcac ccgttcccgg cagcttcgag       180
     accgtcacgt ctccgctctc gttctgggaa cgaatccagc aactgatcct ctctcccgtg       240
     aacggcctgt acggcgtaca ggattcgatc accgggttcg tcgacaccga caacatcgga       300
     cggctcttcg gttcggtcgg cgtagtcctc ttcatcatgg cgctcggcgc cttcatctcc       360
     gtcagttttg ccacacgcag cctggaaacc gctgtctccc aacttgctac caagctcagc       420
     gacaagggct ggctgctcat caccgtcatc atggtgctgt tttcactgct cggttcgacg       480
     atgggcttct cggtcgagac cttcggcttc tacgccttgc tcataccgct gatgacggca       540
     ctgggctatg accgcatggt cgcggccacc atgatcatcc tcggcgcact ggtcggaaac       600
     atggcgtcga cggtcaaccc gttctcgatc ggcgtcgcct ccggcgaagc aggtgtctcc       660
     atcggtgacg gcatcgtgct gcgcgtgatc ctgtggatcg tattgaccgc agtggcagtg       720
     gtattcgttc tccgctacgc cgcaaaggtg aagaaagatc cgtccaagtc gcttgtcggt       780
     ttcgacatcg aggacgacga agacgaggaa ccggccgagc cggtggacat cgacggcaag       840
     ctcaccggaa ctcagaagct ggtactgctc atcaccggac tcaccttcgg actgatgatc       900
     ttctccgtca tcccctggtc gagcatcttc ggcgccacca ccggacccgc cgagtacgac       960
     gcgtaccacg tcacggcaac cgagccctac tggttcgagt tgaactggtg gttcccacaa      1020
     ttggcgatgt tgttcatcct cgccgccgtt ctcgtcggca tagtcgcgaa gatgggtgag      1080
     aagaagatcg tctccctgat cacgcgtgga gccggcgaca tggtcggccc ggcgatcgtc      1140
     atcctgctcg ctcgcggcgt ctcggtgatc atgaccaaca ccgaaaccct cgacaccatc      1200
     ctcaacgcga tggagcaatt ggtcagcggc gcttcggccg gagtcttcgc cattctcgtg      1260
     atgctcgtca acatcccgtt ggcgttcctg atcccgtcca gttccggtca cgccaccctg      1320
     gcgatgccgc tgctcgcccc gctgggcgac ttcgccggag tcagccgcgc actcgtcatc      1380
     accgccttcc agatgggcca cggcctcatg ctgatggtcg ccccgaccaa cgtcgtcgtt      1440
     gtcggcgggc tggccatggc gaaggtcggc tacgacaagt tcctgcgctt cgtctggcca      1500
     ctgctgctga tcaacttcgt gatcgttgtc gtggtgatcg gcgcggcagc ggtattcgag      1560
     tag                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page