(data stored in ACNUC1104 zone)

EMBL: AP008957.PE121

AP008957.PE121       Location/Qualifiers
FT   CDS_pept        complement(139152..140528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30829"
FT                   /db_xref="GOA:C0ZLD9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD9"
FT                   /protein_id="BAH30829.1"
FT                   /translation="MPEEFASPSYSTIKETVAGLMPALESELVELVRIPSIATEGFPSE
FT                   PLFEAHDLIVSLLEKAGVTKIEKLEITGKTAPVIIATVPGPEGAPTVLMYSHYDVVPAD
FT                   DVELWESPPFEPTKRDGAIYGRGTADSKANVIGMIGALRVFDGKPPVTVKLVIEGQEEF
FT                   GSPFDNYPPEAPELFAADAMVIADVGSVRPGSPTLTVALRGSAQVIVELTTLGADKHNG
FT                   LYGGAAPDARLALIRALASLHDDNGDVAVDGLLREPWTGSSYTEEEFRTLAEIRDGLPL
FT                   LGTGGIGERIWSGPAITVTGIDAPPVDGAVNAVASTARAVVNLRVHPRQPAADAQAALI
FT                   RHLEALRPFGLQLTVTAGETGDGFAAAEGGPAFDAALSALSQSWGEPAGLMAGGGSIPL
FT                   VMALDTAVPTAEKLLFGATDGYANIHGPNERVLLDELEKAVVAKALFFQEYAHTFEGKK
FT                   "
     gtgccggaag aattcgcgtc accctcgtat tccacaatca aggaaacagt ggcgggtttg        60
     atgccggcac tggagtcgga actcgtcgaa cttgttcgta tcccgtcgat agcaaccgag       120
     ggtttcccca gcgaacccct gttcgaggct cacgacctga tcgtttctct actggagaag       180
     gccggagtca cgaagataga gaaactcgaa ataacaggta aaactgcgcc cgtcatcatc       240
     gcaacagttc ccggcccaga gggagccccg accgtactga tgtattcgca ttacgacgtc       300
     gttcctgccg acgacgtcga actctgggaa tctccccctt tcgaaccgac caagcgtgac       360
     ggcgcgatat acggccgcgg cactgcagat tcgaaggcaa atgtcatcgg catgatcggc       420
     gcacttcgcg tattcgacgg aaagccgccg gtgaccgtca agctcgtcat cgagggccag       480
     gaagaattcg gcagcccctt cgacaactat ccgccggagg cccccgaatt gtttgcggcc       540
     gacgcaatgg tcatcgccga tgtcggcagt gttcgccccg gctcaccgac cttgaccgtc       600
     gcattgcgcg gatctgccca ggtgatcgtc gaactgacca ctctcggcgc cgacaagcac       660
     aacggccttt acggcggcgc tgcacccgac gcccgcctcg cgctcatccg cgcactggcg       720
     tccctgcatg acgataacgg tgacgtggcg gtcgacggcc tcctccgcga accgtggacc       780
     ggcagttcgt acaccgagga agagttccgc accctcgccg agatccgcga cgggctccca       840
     ctgctcggaa cgggcggcat cggcgaacgc atctggtcgg gcccggcaat caccgtgacc       900
     ggtatcgacg ctcccccggt ggacggcgcc gtcaatgctg tcgccagcac tgcccgcgct       960
     gtggtcaatc tgcgcgtgca cccacgccag ccggcagcgg acgcgcaagc tgcgctgata      1020
     cggcatctgg aagccctgcg ccccttcggt ttacaactga cagtcaccgc aggagaaacc      1080
     ggcgacggat tcgcggcagc cgaaggcgga ccggccttcg acgcggcact gtcggcgctc      1140
     tcgcagtcgt ggggtgagcc ggccgggctg atggcaggcg gcggctcgat ccccctcgtc      1200
     atggccttgg atacagcagt gccgaccgcc gagaagttgt tgttcggcgc caccgacggc      1260
     tacgcgaaca tccacggccc caacgaacgc gtcctgctcg acgagctcga gaaggccgtc      1320
     gtcgccaagg cactgttctt ccaggaatac gcacacacct tcgaggggaa gaaatga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page