(data stored in ACNUC1104 zone)

EMBL: AP008957.PE128

AP008957.PE128       Location/Qualifiers
FT   CDS_pept        complement(150446..151255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30836"
FT                   /db_xref="GOA:C0ZLK9"
FT                   /db_xref="InterPro:IPR015124"
FT                   /db_xref="InterPro:IPR024628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK9"
FT                   /protein_id="BAH30836.1"
FT                   /translation="MTEAQRSFLVCASQRSGSTLLVESLRATGVAGEPEEFFQYLPETS
FT                   RSPQPRQWFEDVTDESVLGLLAPFHPGTPDTRTSEQWRTQLLELGRTPNGVWGGKLMWN
FT                   QTPLLLDRAAGLPWRSGTDLRSALHDTLDHDLQFIHVYREDVVAQAVSMWRAVQTQVWR
FT                   DDATPPNLSDGAQYNALGIAHLVTILGEQERQWKRWFEEEDISPIEIGFRDLTEDPQSV
FT                   VAKTLISLGLDGQLAPPPPLRRQSDGRSREWVQRYRIDAEQNGYPVT"
     atgacggagg cccaacgctc gtttctcgtc tgcgcttcgc agcgcagtgg cagtactttg        60
     ctggtcgaat ccctgcgagc aacaggggtc gcgggtgagc cggaagagtt cttccagtac       120
     ctccccgaga cctcgcgttc gccgcaaccg aggcagtggt tcgaagacgt cacggacgag       180
     tccgtcttgg gtctgctcgc gccgttccac ccgggtacgc cggacacccg cacctccgag       240
     cagtggcgca cacaacttct cgaactcggc cgaacaccca acggagtctg gggcggcaag       300
     ctgatgtgga atcagacacc gctcctgctc gatcgcgcag ccggattgcc gtggcgcagt       360
     gggacagatc tacgttccgc actccacgac actctcgatc acgacctgca gttcatccac       420
     gtctatcgag aagatgttgt cgctcaggct gtatcgatgt ggcgagccgt gcagacgcag       480
     gtctggcgcg acgacgcgac cccaccgaat ctctcggacg gtgcgcagta caacgcgctc       540
     ggaatcgcac acctggtgac gattctcggt gagcaggaac gacagtggaa gcgctggttc       600
     gaggaagagg acatctcccc catcgagatc gggttccgcg atctcaccga agacccgcag       660
     tccgtggtcg caaaaaccct catttccctc ggtctcgacg gacaactggc cccaccaccg       720
     ccgctgcgtc gtcagagcga cggacgctcc cgcgaatggg tgcagcgtta tcgcatcgac       780
     gccgaacaga acggataccc cgtcacatga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page