(data stored in ACNUC1104 zone)

EMBL: AP008957.PE133

AP008957.PE133       Location/Qualifiers
FT   CDS_pept        complement(154093..154821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30841"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL4"
FT                   /protein_id="BAH30841.1"
FT                   /translation="MCSPRLKPKRRYLATHKHLETGSFSMGLFKKRKSRATRKAEAKAL
FT                   KHKAEVEAKLNAKSQRKRDKVETKSLKKLEKAEIESQHKIEKAQIATLKAQEKAAANQG
FT                   LTVAKVRKYLGVARLLAPVLLPIAYRAATAVRAQLDTTRAQKMGIAVDQLGDYTGHGAK
FT                   LSARIAGAESSVTEILSRKPDDAETQRFAAAIRERLGDLSTAVRAAEQMPQARRKAAHQ
FT                   AISSELDGVEADLLARLGVR"
     atgtgctccc ctaggctgaa gccgaagcgc aggtacctgg caacacacaa acacctggaa        60
     acggggtcct tttcgatggg gttgttcaag aagcgaaagt ctcgtgccac ccgcaaggcg       120
     gaggcaaagg ctctcaagca caaggctgag gtcgaggcga agctcaacgc caagagccag       180
     cgtaagcgcg acaaggtcga gaccaagtcg ctcaagaagc tggagaaagc cgagatcgag       240
     tcacagcaca agatcgaaaa ggcgcagatc gcgaccctga aggcgcagga gaaagccgct       300
     gcgaatcagg gcctgactgt cgccaaggtg cgtaagtacc tgggtgtggc acgtctgctt       360
     gcccccgttc tcctgccgat cgcctaccgc gctgccacgg ctgtgcgcgc ccagctcgac       420
     accacgcgcg cgcagaagat gggcatcgcc gtcgaccagc tcggtgacta caccggtcac       480
     ggcgcgaagt tgagcgctcg tatcgccggc gccgagagct cggtcaccga gatcctcagc       540
     cgcaagcccg acgacgcgga gacgcagcgt tttgccgccg ccatccgtga gcgcctcggc       600
     gatctcagca cggcagttcg cgctgccgag cagatgcctc aggctcgccg taaggcagct       660
     caccaggcaa tttcttccga actcgacggc gtcgaagcag atctgctcgc acgtctcggc       720
     gtgcgctag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page