(data stored in ACNUC1104 zone)

EMBL: AP008957.PE134

AP008957.PE134       Location/Qualifiers
FT   CDS_pept        154835..156427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30842"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL5"
FT                   /protein_id="BAH30842.1"
FT                   /translation="MCSVNNPAPQLPIIDSGALTRCRHRVRLDGLFPGKSASEPVDTGV
FT                   KQRQDAAIAKRAEIAELVIGAAPERWVKINPDQSASAQARDTLAACEAGADRIWGAVLP
FT                   VERDTGRKGRCEMLVRDDEGGGYIPVIVVNHKVTDPGQGAITSGLLEWEPAVDPKRKVR
FT                   SQVRDQMRVAQVYRMLERRGLASPSLTAGAIGYNGDCVLVHDLSAILDDYDERFADRIA
FT                   VARGEVLTSPSQVSECKSCPWWTECKQELVRNRDVSLVAVGSRAELLRDVGCNTIDQLA
FT                   AWDGEPLEDWPHGNFDDAVVIAKAWLADAPLVRRFEKISVTRADIEIDVDMESYQEHGA
FT                   YLWGTLLNVGGFSMYRGFATWDPLPTRDEARSFAEFWGWLMAERAAAAASGKTFAAYCY
FT                   SRSAEDKWLLDSARRFAGEPGIPSKDEIREFIDSPQWVDIYQAVSDQFICPNGKGLKKI
FT                   APVAGFNWRDAEAGGEASMAWYREAVGYDGEPDETQRTRILQYNEDDVIATKVLREWMT
FT                   DRAEKEIPLASEL"
     gtgtgttccg ttaacaaccc cgcgccccag ctcccgatca tcgattcggg ggcgttgacc        60
     cgatgccgtc atcgggtgcg tctggacggg ttgtttcccg ggaaatcggc ttcggaaccc       120
     gtcgacaccg gcgtcaagca gcgccaggat gccgcgatcg cgaagcgcgc ggagatcgcc       180
     gaactggtga tcggtgctgc tcccgagcgt tgggtgaaga tcaaccccga tcaatcggcg       240
     tcggctcagg ctcgtgacac tcttgctgcc tgtgaggccg gcgcggaccg gatctggggc       300
     gcggtcttgc ccgtcgagcg cgacaccgga cgcaagggcc gctgcgaaat gctcgtccgt       360
     gacgacgagg gcggcgggta catccccgtc attgtcgtca atcacaaggt gaccgatccc       420
     ggccagggcg cgatcacctc ggggctcctc gaatgggagc ccgcggtcga tcccaagcgc       480
     aaggtccgca gccaggtccg cgatcagatg cgcgtcgcgc aggtctatcg gatgctcgag       540
     cgtcgtgggc tggcgagccc gtcgctcacg gcaggcgcga tcggatacaa cggagactgc       600
     gtcctcgtcc acgacctcag tgcgattctc gacgactacg acgagcgttt cgccgaccgt       660
     atcgctgttg cccgcggcga ggtgctgacg tctccgtcac aggtgagcga gtgcaagtcg       720
     tgcccgtggt ggaccgaatg caagcaggag ttggttcgca accgcgatgt cagcctggtg       780
     gctgtcggat cgcgcgcgga gcttctgcgc gacgtcggct gcaacacgat cgatcagctg       840
     gccgcctggg acggtgagcc gctcgaggac tggccgcacg gaaatttcga cgacgcagtc       900
     gtgatcgcca aggcgtggtt ggcagatgct ccgttggtgc ggcggttcga gaagatctcg       960
     gtgactcggg cggacatcga gatcgacgtc gacatggaga gctatcagga gcacggcgcc      1020
     tacttgtggg gaacgctgct caatgtcggt ggcttctcga tgtatcgagg atttgcgacg      1080
     tgggatccgc tgccgacgcg tgacgaggcg cggtctttcg cggagttctg gggctggctg      1140
     atggcggaac gtgccgcagc cgctgcttcg ggtaaaacct ttgctgcata ctgctattcg      1200
     cgttcggccg aggacaagtg gttgttggac tcggcgcgca ggtttgccgg tgagcccggg      1260
     attccgagca aggacgagat tcgtgagttc atcgacagtc cgcagtgggt cgacatctat      1320
     caagcggtga gtgatcagtt catctgcccg aacggcaagg gactcaagaa gattgccccc      1380
     gtcgccgggt tcaactggcg tgacgccgaa gccggtggtg aagcgtcgat ggcgtggtac      1440
     cgcgaggcgg tcggctacga cggtgagccg gacgagacgc aacggacacg catcctgcag      1500
     tacaacgagg acgacgtcat tgccaccaag gttctacgtg agtggatgac ggaccgtgcg      1560
     gagaaggaaa ttccgctggc ttccgagttg tag                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page