(data stored in ACNUC1104 zone)

EMBL: AP008957.PE16

AP008957.PE16        Location/Qualifiers
FT   CDS_pept        complement(21157..21690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30724"
FT                   /db_xref="GOA:C0ZLF6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF6"
FT                   /protein_id="BAH30724.1"
FT                   /translation="MPLPTFSRMPPRKTLPVPASLLWHSEVMTRVTESLSTQLPDTFDH
FT                   ARARVEDTFDETAAYLEETAARIKESEAADNARRIAAVVATSVARGAGQVGLFLGRQGK
FT                   VLAKKGVERAKAIPTKSAERTEKPRGRKRVAVFVIAGVAVIGGAVFFKSRRREHPPVAS
FT                   APPRLEENSAEKTA"
     gtgccattgc cgacgttctc gcggatgccg ccccgtaaaa ctctccctgt ccccgcctca        60
     ctgttatggc acagtgaagt catgacacga gtgaccgagt ccctcagcac gcagttgccc       120
     gacaccttcg atcacgcgcg cgcccgcgtc gaggacacct tcgacgagac tgccgcctac       180
     ctcgaagaga cagcggctcg tatcaaggag tccgaggcag ccgacaacgc tcgccgcatc       240
     gccgcggtgg tcgcgacgtc ggtcgctcgc ggcgccgggc aggtcgggtt gttcctgggt       300
     cgccagggca aagtcctcgc caagaagggc gtcgagcgcg caaaggctat ccccacgaag       360
     tccgcggaac gcaccgagaa gcctcgtggc cgcaagcgcg tcgccgtgtt cgtcatcgcc       420
     ggtgtcgcgg tgatcggtgg cgcggtgttc ttcaagagcc gccgacgcga gcatccgccg       480
     gtcgcttccg caccccctcg actcgaagag aactcggccg agaagaccgc ttag             534
//

If you have problems or comments...

PBIL Back to PBIL home page