(data stored in ACNUC1104 zone)

EMBL: AP008957.PE160

AP008957.PE160       Location/Qualifiers
FT   CDS_pept        182601..184085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30868"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP1"
FT                   /protein_id="BAH30868.1"
FT                   /translation="MRRSGTPRWVIEICTYSVLAHKTGRVPARFALVRAVVCAGMTLSK
FT                   NRSRLEDLATQAWIFGYPLLIAAVSRDVMTATPTPVAMKAPLNQFAYARTTPDASFTDV
FT                   VSPNADTLYSSGWLDVSTEPQVLSLPDFGTRYWLVPILDAWSDVFTVPGSRTVGRTGGP
FT                   YLVAGPNWKGNVPKGLTLLRSPTAMNWIVARYATSGGTDLAEVHSLQDRTRLTPLSEWT
FT                   GDPKAYTPGEVPVNSAVDTRTPPVDQVAAMDGEAFFTTLDALLDDNPPRPEDTEMMKQL
FT                   SDIGIGSSLPWKSRPQEVRDALDRAARTGMDVLSEIAKEAEGNPKNGWTMHRGLGHYGT
FT                   HYAQRALIVWLGFGANLDADAVYPHATTDVDGKPLTGEKKYVLHFEKDELPPVEGFWSL
FT                   TMMNERQYFVDNPIDRYAIGDRSDLVFADDGSLDIYLQHESPGGEKERNWLPAPSGDFN
FT                   VFLRLYWPKAAVLSGSWTAPGIREASIREASIREAG"
     atgcgtcggt ccggcacacc tcgttgggta atcgaaatat gcacctattc ggtactggca        60
     cacaagacag ggagagtgcc agccaggttt gcgctggtga gagcggtggt atgcgcaggc       120
     atgactctgt cgaagaaccg ttctcggctc gaagacctgg caacgcaggc gtggatcttc       180
     gggtatcccc tgttgattgc ggcggtatcg cgtgacgtca tgacggcgac gccgaccccg       240
     gtggcgatga aagccccgct caaccagttc gcttatgcgc gtacgacgcc cgacgcgagc       300
     ttcaccgatg tcgtctcgcc gaacgcggac actctctact cgtcggggtg gctggacgtc       360
     tcgacggaac cgcaggtgct ctcgctgccg gacttcggca cccggtactg gttggtcccc       420
     atcctcgacg cgtggagcga cgtcttcacg gtgccgggat ctcggacggt aggacgcacc       480
     ggggggccgt acctggtggc cggaccgaat tggaaaggca acgtgcccaa gggtttgacg       540
     ctgctgcggt cgccgacggc gatgaattgg atagtcgccc gctacgcgac gtcaggggga       600
     acggacctgg ccgaagtgca cagcctgcag gaccggacgc gactcacacc actgtcggaa       660
     tggacgggtg acccgaaggc ctacacgccc ggagaagttc cggtgaactc cgctgtcgac       720
     acgcgcacac cgccggtgga ccaggtggca gcaatggacg gcgaggcctt tttcaccacg       780
     ctcgacgcac ttctcgacga caatcctccg cgtccggagg ataccgagat gatgaaacag       840
     ctgtccgaca tcggaatcgg ctcctcgttg ccctggaaat cgcgtccgca agaggtgcgt       900
     gatgccctcg accgagctgc gcgaaccgga atggacgtgc tgagcgagat cgccaaggag       960
     gcggaaggca acccgaagaa cggctggacg atgcaccgcg gcttggggca ttacggaact      1020
     cattacgctc agcgggcgct gatcgtctgg ctcggtttcg gggccaacct cgacgcagat      1080
     gccgtgtacc cgcacgccac caccgacgtc gacggtaagc ctctgaccgg tgagaagaag      1140
     tacgtacttc atttcgagaa ggacgagctc ccgccggtcg agggattttg gtcgctcacg      1200
     atgatgaacg agcgacagta cttcgtggac aacccgatcg atcgatatgc catcggcgat      1260
     cgaagtgatc tggtgttcgc cgacgacggc tcgctggaca tctatctcca gcacgagtcg      1320
     cctggtggcg agaaggagcg gaactggctg ccggctccgt ccggtgactt caacgtcttt      1380
     ctgcgcctgt actggccgaa ggctgcagtg ctttcgggat cgtggaccgc gcccggtatt      1440
     cgggaagcaa gtattcggga agcaagtatt cgggaagcag gctga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page