(data stored in ACNUC1104 zone)

EMBL: AP008957.PE162

AP008957.PE162       Location/Qualifiers
FT   CDS_pept        184804..185952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01620"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30870"
FT                   /db_xref="GOA:C0ZLP3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP3"
FT                   /protein_id="BAH30870.1"
FT                   /translation="MFSKKGKPAAAAPAPIPTLSGSANWSIPRGLIVLLGLAATVVAVG
FT                   GMKVFGGILGPVFLALVLTIAVQPIQDWSQRRGWPKWVGMLGSLVTVYLILLGLAASLI
FT                   VSTAQLATILPQYSEEMTNLLNEGRDKLADFGVSTEQIQSTLSSIDLTKVVGVLESGLE
FT                   GLLGILSDLVFILALLLFMAFDGMSIRSRLNVLSEQRPEISYALSTFAAGTRKYLVVST
FT                   VFGLIVAVLDGGALWLMGIQLPVLWALLSFITNYIPNIGFVIGVIPPALLGLLQGGPWL
FT                   MLWVIVVYSVINFVIQSIIQPKFVGDAVGLSVTMTFLSLVFWAWVLGALGALLAIPLSL
FT                   LVKAVLLDIDPATRWADILISGPRTEPDEDPKEEAKPTPAPT"
     gtgttctcta agaagggcaa gccggccgct gcggctcccg ctccgatccc cacgctttcg        60
     ggtagtgcga actggtcgat cccgcgcggt ctgatcgtcc tgctcggtct cgcggccacc       120
     gtggttgccg tcggcggaat gaaggtgttc ggcggcatcc tcggaccggt attcctggcc       180
     ctcgtgctga cgattgccgt tcagcccatt caagattggt cacagcgccg agggtggccc       240
     aagtgggtcg ggatgctcgg ctcactggtc accgtgtacc tgattctgct cgggttggcg       300
     gcgtcgttga tcgtgtcgac ggcccagttg gcgacaatcc tgcctcaata ctccgaggag       360
     atgaccaacc tcctcaacga gggccgcgac aagttggccg acttcggagt cagcaccgaa       420
     cagatccaaa gcacactcag cagtatcgat ctcacgaagg tcgtgggcgt actcgaaagt       480
     gggctggagg gtctgctcgg cattctgtcg gatctggtgt tcatcctcgc gctgttgctg       540
     ttcatggctt tcgacggcat gagtatccgc tcacggttga atgtgctgtc ggagcaacgt       600
     cccgaaatct cctacgcgct ctccaccttt gccgccggca ctcgcaaata tctggtcgtc       660
     tcgacggtct tcggcctcat cgtggcggta ctcgacggtg gcgcgctgtg gctgatgggc       720
     attcagctgc ccgtcctgtg ggcgttgctg tccttcatca ccaactacat ccccaacatc       780
     gggtttgtca tcggcgtcat cccaccggcg ctcctgggac tcctgcaggg cgggccgtgg       840
     ctgatgctgt gggtgatcgt cgtctactcc gtcatcaact tcgtgatcca gtccatcatc       900
     caacccaagt tcgtcggcga cgccgtgggg ctgtcggtga cgatgacctt cctctcgctt       960
     gtcttctggg cgtgggttct cggagcactc ggagcattgc tggcgattcc gctctcgttg      1020
     ctggtgaagg ccgtcctgct cgacatcgac ccggccacac gctgggcgga catcctgatc      1080
     agtggtcctc gaaccgaacc ggatgaagac ccgaaagaag aagcgaaacc gaccccggcg      1140
     cccacctag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page