(data stored in ACNUC1104 zone)

EMBL: AP008957.PE165

AP008957.PE165       Location/Qualifiers
FT   CDS_pept        188228..189406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01650"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30873"
FT                   /db_xref="GOA:C0ZLP6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP6"
FT                   /protein_id="BAH30873.1"
FT                   /translation="MPAPVFLPESPEAAAPRVNLPGADLLRALAVAAVIYSHISFYVID
FT                   DLGSGWWVIDVVYGVLIEPAELNQHLSFVGVAVFMMLTGALVTRSAIRDGPGKFLTNRF
FT                   SRLLPAFWVATAIAILLVRLGINGMFSGQEGISDTEALMSFFLGGFFLKPEVAVLGVTW
FT                   TLTVQFLFYLACVAARPILRLRPIVMPLAGGALCSLVLLYNVYAPLPYTVPMLSKIAAT
FT                   LPAVFLGQIMYLAWAKLAPGRWLIVAVLVQMHVIIVATQFRVYWAGEHYLWTISVVAAA
FT                   VVLIGRYDGVPTRWSVVKWLSTRSYIIYLVHTLILYRVVENTVLYVGPTLAFALFLLTT
FT                   AAVAEIGYRWVELPGARAVTAWRNSRSRVASKHELVRRHSGTSVRKIHADRA"
     atgcccgcac cagttttcct cccggaatca ccagaggcgg ccgcgcctcg ggtgaatctt        60
     ccgggcgctg acctgctgcg agcactggcg gttgccgccg tgatctactc ccacatctct       120
     ttttacgtca tcgacgatct cggctccggt tggtgggtga tcgacgtcgt ttacggcgtt       180
     ctgatcgagc ccgccgaact caaccagcac ctctcttttg tcggcgtcgc ggtattcatg       240
     atgctgaccg gcgctctggt gacgcggtcc gcgattcgtg acggccccgg aaagttcttg       300
     accaaccgat tcagccgcct gctgcctgca ttctgggtgg caaccgcgat tgccattctt       360
     ctggtccgcc tcggaatcaa cggaatgttc agcggtcagg aaggtatttc cgataccgaa       420
     gcgttgatga gcttttttct cggcggattc tttctcaaac ccgaggtagc ggttctcgga       480
     gtgacctgga cgctcaccgt ccaattcctc ttctatctcg cctgcgtcgc ggctcgaccg       540
     atattgcgtc tgcgtccaat cgtcatgccg ctcgcgggcg gagcactgtg ctcattggtg       600
     ctgctctaca acgtctacgc gccgttgccg tacaccgtgc cgatgctgtc caagatcgcc       660
     gcgacgctgc cggctgtctt cctcggtcag atcatgtacc tcgcgtgggc gaagctcgct       720
     cccggccgct ggctgatcgt tgccgtcctc gttcagatgc acgtcatcat cgtggcgacc       780
     cagttccgcg tctactgggc cggcgagcac tacctgtgga ccatttcggt agtcgccgca       840
     gcggtagttc tcatcggccg ctacgacggt gtcccgacgc gctggtcggt ggtgaaatgg       900
     ctctcgacgc gcagttacat catctatctt gtgcacaccc tgatcctgta ccgcgttgtc       960
     gagaacaccg ttttgtacgt cggaccgacg ctggcgttcg cgctgttcct tctgacaacg      1020
     gccgcggtag cagaaatcgg ctaccgctgg gtggagctgc ccggcgcccg cgcggtgacg      1080
     gcgtggcgaa acagccgctc gcgcgtagca tcgaagcatg agctggtacg acgacattct      1140
     gggacgagcg tccgcaaaat ccacgctgat cgcgcctga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page