(data stored in ACNUC1104 zone)

EMBL: AP008957.PE167

AP008957.PE167       Location/Qualifiers
FT   CDS_pept        190170..190766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30875"
FT                   /db_xref="GOA:C0ZLP8"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP8"
FT                   /protein_id="BAH30875.1"
FT                   /translation="MSGSTRGTASLLRRTIHVGHDPMVRRSDRIEGFMSFGLIIFAILL
FT                   LPLAVWAGAATASSQNALIAKQSAELHSISATTTADSTQTTASTADYIAPTTEMASAQW
FT                   NWNGEVHTGDVTVDSATPVGTEVPIYVNDHGDKTVAPITQSAADVAAVVTGVFTWFSVM
FT                   SLLVIAFMLVRVFLDRSRSAQWDRDLRAFLDANAL"
     atgtcaggta gtacgcgagg aactgcgtcg ctgctccgac gcaccattca tgtaggccac        60
     gatccgatgg ttcgccgcag tgatcggatc gaaggattca tgtccttcgg tctgatcatt       120
     ttcgcgattc ttctgctgcc tctcgcggta tgggcagggg ctgcgacggc ttcgagccag       180
     aacgcactga tcgccaaaca atccgccgaa ctacacagca tttcggcgac gacgactgca       240
     gattcgacgc agaccaccgc ctcgacagcc gattacattg cgccgaccac cgaaatggcc       300
     agcgcgcaat ggaactggaa cggtgaggtt cacacgggtg atgtcactgt cgactcggcg       360
     acgcccgtcg gcaccgaggt ccccatctac gtcaacgatc acggcgacaa gaccgtagct       420
     ccgatcacgc agagtgctgc cgacgtcgca gccgtggtca ccggggtttt cacctggttc       480
     agcgtgatgt ccctgttggt catcgcgttc atgctggtgc gggtctttct cgatcgttcc       540
     cgctcggccc agtgggaccg agacctacgc gcgttcctcg acgcgaacgc gctgtag          597
//

If you have problems or comments...

PBIL Back to PBIL home page