(data stored in ACNUC1104 zone)

EMBL: AP008957.PE176

AP008957.PE176       Location/Qualifiers
FT   CDS_pept        199201..199875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30884"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ7"
FT                   /protein_id="BAH30884.1"
FT                   /translation="MGRHRKSEPTRPGGRMAAVSVATGAILASGTSIGHASPLPVATEG
FT                   PALVSVPEILDLVRTTDLAGIAEQLGKTRQLEAERAALAYEVEKPRVMAPVSGTMTSNF
FT                   GPRWGTTHYGLDIANSIGTPIVSATDGVVIESGPAAGFGLWVRIQQDDGTVGVYGHINE
FT                   ALVVAGQKVRAGELIATVGNRGQSTGPHLHYEVWQSDGQKTDPLAYLNSRGVSFGEKAA
FT                   SG"
     gtgggaagac atcgaaaatc cgagccgacc agacccggcg ggcgcatggc cgcggtttcc        60
     gtggcgacgg gtgcaatcct ggcgtccggc acttccatcg ggcacgcatc gccgcttcca       120
     gttgcaacgg aaggtccagc gctggtgtcg gtgccggaga tactcgacct tgttcggacg       180
     acggatcttg ccgggatagc cgaacaactc ggtaaaacga gacaactcga agccgaacgg       240
     gcggctttgg cgtacgaggt agaaaagccg cgggtgatgg cccccgtcag cgggacgatg       300
     acgtccaact tcggtccacg ctggggaaca acccattacg gtctcgacat cgcaaactcg       360
     atcggtacgc ccatcgtctc ggcgaccgac ggtgttgtga tcgaatccgg tcccgccgcg       420
     ggattcgggc tctgggtccg catccagcag gacgacggga ccgtcggcgt ctacgggcac       480
     atcaacgagg cgctcgtggt tgccggtcag aaggtgcggg cgggtgaact gatcgcgacc       540
     gtcggcaatc gtggacaatc gacgggaccg cacctgcact acgaggtgtg gcaatctgac       600
     gggcagaaga ctgatccgct cgcgtatctg aattcccggg gcgtgtcgtt cggggagaag       660
     gccgcgagcg gctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page