(data stored in ACNUC1104 zone)

EMBL: AP008957.PE182

AP008957.PE182       Location/Qualifiers
FT   CDS_pept        complement(203515..203985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR3"
FT                   /protein_id="BAH30890.1"
FT                   /translation="MNTAHRRFRTAAVIAASAGAALLATSCSGTFDKFDESKAYKKTET
FT                   FSFAQASNGIDTLPSWVPAGATGIDEVIRTTGNERILRMTANITEIDHNSCIARPTVET
FT                   RPASLSAQWWPTGVEKGSSFQCGDWYVGEKDSFVYGYRPETLDFIIDQLDNK"
     atgaacacag cacaccgccg attccgcacc gccgccgtca tcgccgcctc ggccggagcg        60
     gctttactgg ccacgtcctg ctcgggcacc ttcgacaagt tcgacgagtc gaaggcatac       120
     aagaaaaccg aaaccttctc ttttgcacaa gcatccaacg gaatcgacac actgccgagt       180
     tgggttcccg ccggcgcgac gggtatcgac gaggtcatcc gcaccaccgg caacgaacgc       240
     atcctgcgca tgactgcgaa catcacggag atagatcaca acagctgcat cgcacgacct       300
     accgtcgaaa ctcgtccggc atcgctgtcc gcacagtggt ggccgacggg ggtcgagaag       360
     ggcagttctt tccagtgcgg cgactggtac gtcggcgaaa aggactcgtt cgtctacgga       420
     taccggccgg aaactctcga cttcatcatc gatcagctcg acaacaagta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page