(data stored in ACNUC1104 zone)

EMBL: AP008957.PE184

AP008957.PE184       Location/Qualifiers
FT   CDS_pept        complement(205469..206290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01840"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30892"
FT                   /db_xref="GOA:C0ZLR5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR5"
FT                   /protein_id="BAH30892.1"
FT                   /translation="MNARETVRTWLRPPSPVRTDPELDPAARRGIRIEITIVLLVTFGL
FT                   SGLSGILSLAESLATPVALSDQTVALNPSRAAIDWIDLARQLLGVAKLLAWAALGLYLL
FT                   WRSGIGPRAAGLTPKPRFGRDIAPGFGLAAVIGLPGLLFYLVAQALSINLTVQASALDD
FT                   HWWRVPILVLSAIANSGAEEVLVVAYLITRLRTLGWSENKSLLASSLLRGSYHLYQGFG
FT                   GGVGNVIMGLVFGRYWQRTGKLWPLIIAHALIDMVAFIGYALLRDHVSWLP"
     gtgaatgccc gcgaaaccgt ccgcacctgg ttacggccgc cgtctcccgt tcgaacggac        60
     ccggaactcg atcccgccgc cagacgcgga atccggatcg agatcactat cgttctgctg       120
     gtcaccttcg ggctcagcgg attgtccggg atcctttcgc tcgccgaatc cttggcgacg       180
     ccggttgcgc tctcggatca gacggttgca ctcaacccgt cgcgagctgc catcgactgg       240
     atcgacctgg cgcgccaatt actgggcgtt gcaaagcttc tcgcgtgggc agcgctggga       300
     ctctatctac tgtggcgttc ggggatcggt ccacgtgctg cgggcctgac tcccaaacct       360
     cgattcggtc gcgacatagc tccgggattc ggcctcgccg ctgtgatcgg cctccccgga       420
     ctcttgttct acctcgtcgc tcaggcactg agcatcaacc tcaccgtcca agccagcgcg       480
     ctcgacgacc actggtggcg ggttccgatc ctcgtactgt ccgcgatcgc gaactcgggc       540
     gccgaagagg tactggtcgt cgcctacctg atcactcgcc tccgaacact cggctggagc       600
     gagaacaaat ctctgctcgc gtcctcactc ctgcgcggta gttatcacct ctaccaaggg       660
     ttcggcggcg gtgtgggaaa cgtgatcatg gggctcgtgt tcggtcgata ctggcagcgc       720
     accggcaagc tgtggccgct gatcatcgcc cacgcgctca tcgacatggt ggcgttcatc       780
     ggttacgccc tcctgcgcga tcacgtctcc tggctgccgt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page