(data stored in ACNUC1104 zone)

EMBL: AP008957.PE185

AP008957.PE185       Location/Qualifiers
FT   CDS_pept        complement(206301..207080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30893"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR6"
FT                   /protein_id="BAH30893.1"
FT                   /translation="MATKTSTGPSTAERVRSACVRAQDAVLAIEGSDPTVTSVHHLRSN
FT                   GDVVVAVPHASAAAALAWNSGGGGLPAVLEITDHAPLRLREPVRSLVWLRGSLHAVPDY
FT                   EARVLADDVASEHPHPGLLDIGHTSVLLRLSLASAVVADSTGAEPVAVDELLNASPDPF
FT                   WEMETAWLQHLDEDHRDLVDLLVRKLPPYMRTGRVRPLGIDRYGLRLRVEDHTGDRDVW
FT                   MPFANPVDDAPALSRAIRMLVGCPFLNGLRSGGAANG"
     atggcaacga agaccagcac cggcccgtcc accgccgaac gcgtccgcag cgcctgtgtg        60
     cgcgcacagg acgcagttct cgccatcgaa ggcagcgatc ccaccgtcac gtcggtgcat       120
     cacctgcgtt cgaacggtga cgtcgtcgtt gcagtcccac atgcctccgc agctgcggcc       180
     ctggcctgga actccggcgg cggcggactg cctgccgtcc tcgagatcac cgatcacgca       240
     ccactgcggc tgcgtgagcc cgtgcgctcg ctcgtgtggc ttcgcggctc gttgcacgcc       300
     gtgcccgact acgaggcacg cgttctcgcc gacgacgtcg catccgaaca tccccacccg       360
     gggctcctcg acatcggcca cacctcggtc ctccttcgcc tgagcctggc ctcggccgtt       420
     gtcgccgact cgacgggggc agagcccgtc gccgtggacg aactgctgaa cgccagcccc       480
     gatcccttct gggaaatgga gacggcgtgg ctgcagcatc tcgacgaaga ccaccgcgat       540
     ctcgtggacc tgctcgtgcg caagcttccc ccgtacatgc gcaccggacg cgttcgccca       600
     ctcggcatcg accgctacgg actgcgcctg cgggtcgagg atcacaccgg tgaccgcgac       660
     gtgtggatgc cgttcgccaa ccccgtcgac gacgctcccg cgctgagtcg cgccatccgc       720
     atgctggtcg ggtgcccttt cctcaacggc ctccgatcgg gtggcgctgc aaacggctag       780
//

If you have problems or comments...

PBIL Back to PBIL home page