(data stored in ACNUC1104 zone)

EMBL: AP008957.PE186

AP008957.PE186       Location/Qualifiers
FT   CDS_pept        207220..207858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30894"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR7"
FT                   /protein_id="BAH30894.1"
FT                   /translation="MAIPLSLGLPAPRNSRGLLEALFLPVVPASALIGGEAAGRVVVRL
FT                   DIDPEELRADTEASYEAVRFDVDVTTDQIDDAIALRLPAPLAVYVDGGEEDLTPAEAAL
FT                   RLCEGGRIPGLAAGRTPTEVADFLAVLAHESVGFVARAADGDEVIALLCGTAAALRGDD
FT                   VRAAIVDPKPEKLAALIPEAASAMREVLLTIEVADLPAVETALRAAGLQ"
     gtggccattc ctctttcact cgggctgccc gccccgagaa actcgcgcgg acttctcgaa        60
     gcactctttc tcccggtcgt tccggcttcg gcgctgatcg gtggcgaagc agcaggccgg       120
     gttgtcgttc gcctcgatat cgatccggaa gaactgcgtg cggacacgga agcgtcgtac       180
     gaggccgtcc gtttcgacgt cgacgtcacc accgaccaga tcgacgacgc gatcgcgcta       240
     cgtctgcccg ctccgctcgc ggtgtacgtc gacggcggcg aagaggatct gacacccgcc       300
     gaagcggcgc tgcgcctgtg tgaaggtgga cggatccccg gactcgccgc cggtcgtacg       360
     cccaccgaag tggctgattt cctggcggta ctcgcgcacg agtccgtcgg tttcgtagcc       420
     cgcgcagccg acggcgacga ggtgatcgcc ctactgtgtg gcaccgccgc tgcactgcgc       480
     ggcgacgacg tgcgcgccgc gatagtcgat ccgaagcccg aaaaactcgc cgcgctgatc       540
     ccggaagccg catccgcgat gcgcgaggtg ctgctcacga tcgaggttgc agatctgcct       600
     gcggtggaaa cggctctgcg tgccgcgggt ttgcagtga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page