(data stored in ACNUC1104 zone)

EMBL: AP008957.PE189

AP008957.PE189       Location/Qualifiers
FT   CDS_pept        complement(209479..211581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01890"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30897"
FT                   /db_xref="GOA:C0ZLS0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS0"
FT                   /protein_id="BAH30897.1"
FT                   /translation="MQFSRQPSSPGEQGSVATIDRPNEERATTPHRQDLNGLRGLAIGL
FT                   VVVFHVWFGQVSGGVDVFLVLSGYFFVGSLVRRAEAGGSLNPVPALRRVFLRLFPLIAV
FT                   VSILTALGTALLLPRTRWADLGDQLIAVLGFFQNWQLASTASDYLAADGSVTPLQHLWS
FT                   MAVQGQFYLLAIALVSVIAYVASRVNPNYFRPSLAVTLLVLTAGSFLYALAKSSRHQAW
FT                   AYYDSGARLWELALGGLLAVLMTSTRSRQIASLPFSVRATIGWAGLSSILLCGIVLDGA
FT                   QQFPGPWALVPVLATLALILSGVGDDTPWTSKTLAHPALTWLGSFAFALYLIHWPILVF
FT                   ALVITGRPEAGLLGGALIIALSVAGALALRRLVEVPVERGGRSRRYTVLACVVTAAAVL
FT                   AASVAWQSYASSQTTGQRAVDTLDLPTHPGALALTDGAEVPKASMVPSIFDAPLDLPAS
FT                   TLDGCIADFLERDVVHCTYGDADADRTIALAGGSHSEHWLTALDELGKSHGFRVDTYLK
FT                   MGCPLTVDSMQTLSDNDYPDCVDWSRGVLTELADASPDFVFTTATRPSSDGPGDVTPES
FT                   YVHVWQELERDGIDVLAIRDTPWLHHDGVAYRAIDCLATTTSPDHCAMPRSEMLSDVNP
FT                   APSAIADLTNVRLLDLSDGVCGPELCRVVEGNVLVYHDSHHLTASYVSTLSAELGRQLS
FT                   VQTGWW"
     atgcagttct cgcgtcaacc gtcgtcaccg ggcgaacaag gctcggtcgc cacgatcgac        60
     cggccgaacg aagaacgggc aacaacaccg caccgacaag acctgaacgg actgcgtggc       120
     ctcgccatcg gtttggtggt cgtattccac gtgtggttcg gacaggtatc gggcggggtg       180
     gacgtcttcc tggttctgtc cggatacttc ttcgtcggct cactggttcg acgcgccgaa       240
     gccgggggtt cactcaaccc ggtcccggca ctgcggcggg tgtttctgcg gctgttcccc       300
     ctgatcgcgg tggtcagcat tttgaccgca ctggggaccg cgttgctgct gccacgcaca       360
     cgctgggccg atctgggtga tcaactgatc gcggtgctcg ggttcttcca gaactggcag       420
     ctcgccagca ccgcaagcga ctacctggcc gctgacggct cggtcactcc cctgcagcac       480
     ctgtggtcga tggccgtgca aggtcagttc tatctcctgg ccatcgcact cgtctccgtg       540
     atcgcttatg tggcttcacg cgtgaatccc aactatttcc gcccgtcact cgcggtcacc       600
     cttctggttc tgaccgcagg atcttttctc tacgcactcg ccaaatcttc gcgtcaccaa       660
     gcctgggcgt actacgactc cggcgccagg ttgtgggaat tggccctcgg tggtctgctg       720
     gccgttctga tgaccagcac gcgcagtcgg cagatcgcat ccctgccgtt ctcggtcaga       780
     gcgacgatcg gctgggcggg gctttcgtcg atcctgttgt gcggcatagt gctcgacggc       840
     gcccagcagt tccccggccc gtgggcgctg gtaccggtgc tggccactct tgcgttgatc       900
     ctgtccggag tcggcgacga cacaccttgg acgtcgaaga cgctcgccca tccggcactg       960
     acgtggctcg gctcgttcgc attcgcgctg tacctgattc actggccgat tctggtgttt      1020
     gcactcgtga tcaccggacg ccccgaagcc ggcctgctcg gcggggcact gatcatcgcc      1080
     ctctccgtcg cgggggcgct tgcactccgg cgcctggtcg aggttccggt ggagcgcgga      1140
     ggccgctcgc gccggtacac cgtcctggca tgcgtcgtca ccgctgccgc ggtcctcgcc      1200
     gcttcagtcg cctggcagtc gtacgcgagc agccagacga cgggccagcg ggcggtcgac      1260
     accctcgacc tcccgaccca tcccggcgca ctcgcgctca ccgacggtgc cgaagtaccc      1320
     aaggcgtcga tggttccctc gatcttcgat gcgccactgg accttccggc cagtacgctc      1380
     gacggctgta tcgccgattt tctcgagcgg gacgtcgtcc actgcaccta tggcgacgcc      1440
     gatgcagaca gaaccatcgc gctcgcgggt ggttcgcact ccgagcactg gctcactgcg      1500
     ctcgacgaac tcggcaagag tcacgggttc cgcgtcgaca cgtatctgaa gatgggctgc      1560
     ccgctcaccg tcgactccat gcagacgttg tcggacaacg actatccgga ttgtgtcgac      1620
     tggtcgcgtg gagtgctgac cgagttggcc gacgcctcac ccgatttcgt gttcacgacg      1680
     gcaaccaggc cgagttccga cggccctggt gacgtgacgc cagagtcgta cgttcacgtc      1740
     tggcaggaac tggagcgcga cggtatcgac gtcctcgcca tccgcgatac cccctggctg      1800
     caccacgacg gcgtcgccta ccgcgcgatc gactgtctgg cgacaaccac gtcacccgat      1860
     cactgcgcga tgccacggtc cgaaatgctc agcgacgtca atccggcgcc gtcggcaatt      1920
     gccgatctga ccaacgtccg cctactcgat ctcagcgacg gtgtgtgcgg cccggagttg      1980
     tgccgcgtcg tggagggaaa tgtgttggtg tatcacgatt cccaccacct gacagccagc      2040
     tacgtgagca cactttccgc tgaactcggg cgccaactga gcgtccagac cggttggtgg      2100
     tga                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page