(data stored in ACNUC1104 zone)

EMBL: AP008957.PE190

AP008957.PE190       Location/Qualifiers
FT   CDS_pept        complement(211622..212440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30898"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS1"
FT                   /protein_id="BAH30898.1"
FT                   /translation="MVDLGTSPDGWNLPVVALSQDEIDYVRERLGLDALPVVLGGATVH
FT                   ASASAHHTAMQSAADSLSERDLLPGGEIHHELSARLRVLTHPKWELALRRHVGGRISRL
FT                   CVAQGEFLCVEATSTDSSFALCSVTAEPAAPVVTALGSAEAMPIAVINAPTEMLSLAFG
FT                   AGPDADSVTSALINAGIPEDDARQLGSAIVTCTAFAELVGIPHSLGATTLMTGAVTVYD
FT                   TLAGRLVGSTTRAADGTEWTSISSGTLHRLRQAVNALVTELEESTPETSG"
     atggtggacc tcggcacctc acctgatggg tggaatttgc ctgtcgtcgc cctctcacag        60
     gacgaaatcg actatgtacg tgagcgactc gggctcgacg cgcttcccgt ggttctcggt       120
     ggcgcgacgg ttcacgccag tgcgagcgct caccatacgg cgatgcagtc cgcggcagat       180
     tcgctctccg agcgcgatct cctccccggc ggggagatcc atcacgaact cagtgcccgc       240
     ctgcgcgtcc tgacccaccc caagtgggag ttggcgctgc gtcggcatgt cggtggaagg       300
     atttcacgcc tctgcgtcgc acagggcgaa ttcctttgtg tcgaagcaac ttcaaccgat       360
     tcttcgttcg cattgtgcag cgtcaccgcc gaaccagctg cacccgtcgt caccgcgctc       420
     ggcagcgccg aagcaatgcc gattgccgtg atcaacgcac cgaccgagat gctcagcctg       480
     gcattcggcg ccggcccgga tgcagacagc gtgacctcgg ccttgatcaa cgccgggata       540
     cccgaagacg acgcgcgcca actgggtagc gcaatcgtca catgcaccgc cttcgccgaa       600
     ttggttggaa taccacacag tttgggagcg acgacgctca tgaccggcgc agtgactgtg       660
     tacgacacct tggccggccg gctcgtgggt tcgactactc gggctgccga cggcaccgag       720
     tggacgtcca tcagttccgg aacactccat cgcctgcgac aagccgtgaa cgcgctggta       780
     accgaactcg aggaatcgac gccggagact tccgggtaa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page