(data stored in ACNUC1104 zone)

EMBL: AP008957.PE191

AP008957.PE191       Location/Qualifiers
FT   CDS_pept        complement(212440..213708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30899"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS2"
FT                   /protein_id="BAH30899.1"
FT                   /translation="MVGITGIIWYPRGAAPNSAALVAGAGPVPLGVAAGAWSTVSSGLT
FT                   DTAASISRVMADLRTGWSGEAADAASSKFAPFQEWAAAAALLAGETAGKAQVQSGSYTV
FT                   ATLAMPSLAEIAAVQAAKVAAYSIGGALVGGAAAAEAAEEALKIRAAVTMETYDAATTH
FT                   LAVQQNFDSPPSIAEPTAGASASAESPGSAARQSVVQAASTLADVIADPVRAATAAVAS
FT                   VVSNPVFAAAASQAGAISGGASAAVSAATTAVTGATTAASTLATAGAGLTGLGGAGLGG
FT                   AGLGGARLGASTPSLFGTPSASRATAQVSAASATTRAGAFAGSSSSSSTGRHALPDPST
FT                   GQSAARQNPVTSPVQGTVDTVKVDPARTAGGSAPIAGGRHAAQSEDETEHDTPDYLKHF
FT                   EHFADGRTVIPSVIGGALETAER"
     atggtcggca tcaccggcat catctggtat ccacggggcg cagcacccaa ctctgcagca        60
     ctggtcgccg gggccgggcc ggtccctctc ggtgtggcgg ccggggcctg gtccaccgtg       120
     tcgtccggac tgaccgacac cgctgcgtcc atctctcgcg tgatggcgga ccttcgcacc       180
     gggtggtcag gagaagccgc ggatgccgcg tcgagcaagt tcgcaccgtt ccaggaatgg       240
     gctgccgcgg ccgcgctgct cgcgggagaa accgctggta aagcccaagt gcagtccggt       300
     tcctacaccg tcgccaccct ggccatgccg tccctggcgg agatcgcggc agttcaagcg       360
     gccaaggtcg ccgcgtactc catcggcggg gccctggtcg gcggggccgc tgccgccgag       420
     gctgccgaag aagctctcaa aattcgagcg gcggtgacga tggaaacgta cgacgccgca       480
     acgacgcatc tggccgtgca gcagaacttc gactcaccac cgtccatcgc ggaacccaca       540
     gctggggcat ccgcttcggc cgaaagccca ggcagcgccg cacgacagtc cgtcgtgcaa       600
     gcggcatcaa cgctcgctga cgtaatcgcg gatcccgtgc gcgccgcaac cgctgctgtc       660
     gcatccgtag tttccaaccc ggtatttgcc gccgctgcct cacaggccgg tgccatctcc       720
     ggtggagcgt cggccgccgt aagcgccgcg accaccgccg tcacgggcgc caccactgcc       780
     gcatcaactc tcgcgacggc cggagcagga ctcaccggac tgggcggcgc agggctcggt       840
     ggcgcagggc tcggcggcgc gagactcggt gcttccacac catcactgtt cggcaccccg       900
     tcggcgagtc gggcaacggc acaggtcagc gcagcttccg cgactaccag agccggagca       960
     ttcgcgggct cgtcgtcgag cagcagcacc ggccggcacg ctcttccgga tccctccacc      1020
     ggccagagcg ccgcgcgcca gaaccccgtg acctcgccgg ttcagggcac cgtcgatacc      1080
     gtcaaagtgg atccggcccg aaccgcaggc ggatctgcgc cgatcgccgg cggccgtcat      1140
     gcggcccaat ctgaagacga gaccgagcac gacacacctg attatctgaa gcacttcgag      1200
     cacttcgccg acggccgaac agtcatcccg tccgtgatcg gtggcgcact cgaaactgca      1260
     gagcgttga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page