(data stored in ACNUC1104 zone)

EMBL: AP008957.PE192

AP008957.PE192       Location/Qualifiers
FT   CDS_pept        complement(213761..214060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30900"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS3"
FT                   /protein_id="BAH30900.1"
FT                   /translation="MHVDPQALVAAAMELESAATRLRGIVSTAQPTLRVLPAGSEEVSG
FT                   SAANYFNTISGSLASSTDRAIEELTAAAAALRKNAAAYELEDQLTKSSLAAAPI"
     atgcacgtcg accctcaagc cctagttgcc gccgcaatgg aactcgagtc tgcggcgacg        60
     cgattgcgcg gaatcgtctc tactgcgcag ccgacgctac gcgttctccc agccggatcc       120
     gaggaagtgt ccggtagcgc ggcaaattac ttcaacacca tctcgggcag ccttgcctcg       180
     tccaccgatc gggcaatcga ggagctcacc gcggctgcgg cagctctgcg caagaatgca       240
     gctgcctacg agctcgaaga ccagctcacc aagtccagcc tggcagccgc accgatctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page