(data stored in ACNUC1104 zone)

EMBL: AP008957.PE193

AP008957.PE193       Location/Qualifiers
FT   CDS_pept        complement(214194..214544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30901"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS4"
FT                   /protein_id="BAH30901.1"
FT                   /translation="MTVTMTPDRFEELVGEALDLIPPELAKAIDNVVVLVEARDEEEPG
FT                   LLGLYQGVALTERDSHYGGYLPDTVTIFRDSILDICASEDEVVHEVAVTVIHEIAHYFG
FT                   IEEDRLHELGWG"
     atgacggtga ctatgacgcc cgaccggttc gaggaactgg tcggcgaggc gctcgatctg        60
     attccgcccg aacttgccaa ggccatcgac aacgtcgtgg tgcttgtcga agcacgtgac       120
     gaggaagaac cggggctgct cggtttgtat cagggcgtcg ctctgaccga gcgggattct       180
     cattacggtg ggtacctgcc ggacacggtc actattttcc gcgattcgat actcgacatc       240
     tgtgcatccg aggacgaggt tgttcacgag gttgccgtga ccgtcatcca cgagatcgcg       300
     cactacttcg gtatcgaaga agacagattg cacgaactcg gctggggctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page