(data stored in ACNUC1104 zone)

EMBL: AP008957.PE194

AP008957.PE194       Location/Qualifiers
FT   CDS_pept        complement(214548..215642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30902"
FT                   /db_xref="GOA:C0ZLS5"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS5"
FT                   /protein_id="BAH30902.1"
FT                   /translation="MSEDKIEKSPDPVDPQGTPAKKTVSASRTRRVLAAVAVGAVVAAI
FT                   ATIAISGGLNKDDSSSVSVSGGGPAATGSTRDDAFTAAAAGDCLNWTPATESGGDRTDM
FT                   SKVQCGTEHRFEVAGPLDLSVFPGAEFGPGSRYPGALRFAELRDEHCTPIVMSYLDSKF
FT                   DPKGKFSVGLMFPSESGWASGERALRCGLQFSTTTGELQPFVGRVADQDQSNVWDVGTC
FT                   IGINQNLPTDPVDCAKPHAYEVISVIDLGTQFPGAMPSVEDQDRYLEGVCTQASNEYLG
FT                   SADALRDKTLTLFWDNISLESWLAGSRRVNCSIGKEVETGGFAAITGSAKGEILINGAA
FT                   PVPPPAAPEGRSLPTPLPGAAPPS"
     atgtccgaag acaagatcga gaagtcgcca gatccggtag atccccaggg gacgccggcg        60
     aagaaaactg tctcagcgag tcgcacccgt cgggtcctgg ctgctgtggc ggtaggtgcg       120
     gtggtcgccg cgatcgcaac gatcgcgatt tccggtggat tgaacaagga cgactcgtcc       180
     tcggtcagtg tcagtggtgg cggtccggca gcgacgggat ctactcgcga cgacgccttc       240
     accgcggctg cggccggcga ctgcctcaac tggacgcctg cgaccgagtc gggcggggac       300
     cgcacggaca tgtcaaaggt tcagtgcgga actgaacacc gcttcgaggt tgccggacca       360
     ctcgacctgt cggtgttccc cggcgctgag ttcggccccg gttcccggta cccgggcgcc       420
     cttcgattcg ccgaactccg cgacgagcac tgcacaccca tcgtcatgtc ctacctcgat       480
     tcgaagttcg atcccaaggg caagttcagc gtcggcctga tgttcccgag cgaatcgggt       540
     tgggcttcgg gcgagcgcgc actgcgttgc ggcttgcagt tctcgaccac gaccggcgaa       600
     ctacaaccgt tcgtgggccg cgtggcggac caggaccagt cgaacgtgtg ggacgtcggc       660
     acgtgcatcg gcatcaacca gaacctcccg accgatccgg tcgattgcgc gaaaccgcat       720
     gcatacgagg ttatttcggt gatcgacctc ggcactcaat tcccgggcgc aatgccgtcg       780
     gtcgaagatc aggaccgtta cctcgagggc gtctgcactc aggcgtccaa cgagtacctt       840
     ggttccgcag acgcgcttcg cgacaagacg ctgacgctgt tctgggacaa catttcactg       900
     gaaagctggt tggccggtag ccgccgagtc aattgttcga tcggcaaaga ggtcgaaacc       960
     ggcgggtttg ccgcgatcac cggaagcgcc aagggcgaaa tcctgatcaa cggcgccgct      1020
     ccggtccctc cacccgctgc accggaaggt cggtcgctgc cgacgccgtt gcccggcgca      1080
     gctccgccgt cgtaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page