(data stored in ACNUC1104 zone)

EMBL: AP008957.PE195

AP008957.PE195       Location/Qualifiers
FT   CDS_pept        215653..216120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30903"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS6"
FT                   /protein_id="BAH30903.1"
FT                   /translation="MPVAEAISNLHYKTHKRVCEYFVVMSENTPLDPEAVELAGRLFDM
FT                   ARTGDAAGLASYVDAGVPVNLTNESGDTLVMLAAYHGHADAVVALIERGADVNRPNDKN
FT                   QTPLAGAVFKGEDAVVKALVSGGADPKGGHPTAVDAARMFGREDYLSLLES"
     atgcctgttg ccgaggcgat atcgaacctt cactacaaaa ctcacaaacg cgtctgtgag        60
     tattttgtag tcatgagcga aaacacccca ctcgatcccg aggctgtcga gctggcgggc       120
     cggctcttcg acatggcacg aaccggcgac gcggccgggc tggcgtcgta cgtcgatgct       180
     ggagttcccg tcaatctgac caacgagagt ggcgacacgc tcgtcatgtt ggcggcgtat       240
     cacggtcacg ctgacgccgt cgttgccttg atcgagcgcg gcgccgacgt caaccggccc       300
     aacgacaaga accagacacc cctcgccgga gccgtcttca agggcgagga tgcggtggtg       360
     aaagcgctgg tgagcggggg agccgacccg aaaggtggac acccgactgc cgtcgacgcg       420
     gctcggatgt tcggacgcga ggactacctg agtctgctcg aatcgtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page