(data stored in ACNUC1104 zone)

EMBL: AP008957.PE203

AP008957.PE203       Location/Qualifiers
FT   CDS_pept        227217..228056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30911"
FT                   /db_xref="GOA:C0ZLT4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT4"
FT                   /protein_id="BAH30911.1"
FT                   /translation="MSPDRRISPDRPTLVATDVDGTLIDHDELVSARTRAAVHAVVESG
FT                   TPFLLATGRPPRWISPVVEGLGYAPLAVCANGAVVYDSYADRVLSAATLSVDALTELSE
FT                   LALVALPGSGLAAERVGESAHDAATPQFVSSPDYEHAWLNPDNTEMSEDEVLAAPAVKL
FT                   LIRRPGMTSTAMYDTLAPHVGALADMTYSTENGLIELSAPGITKASGLVAAAERFGFDL
FT                   SGLVAFGDMPNDIPMLGMARLGVAMGNAHPEAKAAADEVTDTNSAHGVAKVLERWWS"
     gtgagcccag accgtcgtat cagccctgac cgcccaacct tggttgcgac cgatgtcgac        60
     ggcaccctca tcgatcacga cgagttggtc agtgcccgca cccgcgccgc cgtgcatgcc       120
     gtcgtcgaat ccggcacgcc gttcctgctg gcaaccgggc gtcctccacg ttggatttcg       180
     cccgtcgtcg aaggtttggg atacgcgcca ctcgcggtct gcgcaaacgg tgctgttgtc       240
     tacgacagtt acgccgaccg cgtcctcagc gccgcgacct tgtcggtcga cgcactcacc       300
     gaactctccg agctggctct ggttgcactt cccgggtcgg gattggcagc ggaacgggtg       360
     ggggagagcg cacacgacgc cgccacccca cagttcgtca gctcaccaga ttacgaacac       420
     gcctggctca acccggacaa caccgagatg tccgaggacg aagtgcttgc ggcgccggcc       480
     gtcaaactcc tgattcgccg tccaggcatg accagcacgg cgatgtacga cacgctcgcc       540
     ccgcacgtcg gtgcgctcgc cgacatgacg tactccaccg agaacggact gatcgaactc       600
     tcggcgccgg gaatcacgaa ggcgtccggc ctggttgccg cggccgaaag gttcggcttc       660
     gacctgtcgg gtctggttgc cttcggggac atgcccaacg acatcccgat gctggggatg       720
     gcacgcctcg gcgttgccat gggcaacgct caccccgaag ccaaagccgc agccgacgag       780
     gtcaccgaca ccaattcggc gcacggggtc gcaaaagtcc tcgagcgctg gtggtcgtag       840
//

If you have problems or comments...

PBIL Back to PBIL home page