(data stored in ACNUC1104 zone)

EMBL: AP008957.PE208

AP008957.PE208       Location/Qualifiers
FT   CDS_pept        235253..236446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02080"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="protein synonym:acyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30916"
FT                   /db_xref="GOA:C0ZLT9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT9"
FT                   /protein_id="BAH30916.1"
FT                   /translation="MGTIMTTPEPIVIVDGARTPVGSFGGVFKDVPAHELGAAAAKAAL
FT                   SRAGVAPEDIDEVVMGCIGQVGPDAYNARRVGIAAGLPENVPAYTVNRLCGSGLQAVWS
FT                   AAMQMRWGAAAITLAGGDESMSRMPFYDFAARSGYKLGDRSLVDGTVAMLTDPFSKAHM
FT                   GRTAEAVARKYGVSREQQDEFAVESQRRAATDAAKAAFAEEITPVETGGRRSVTVTEDE
FT                   HPKPGTTVETLAKLRPAFEEGGSVTAGNASGINDGAGALVLATGTEAAKRGLTGLVTLE
FT                   TVTTAAMEPGLMGYAPVLALEKLFAQTGLKPSDIGTAEVNEAFASQAIAVIRDSGLDPE
FT                   KTNPYGGAIALGHPVGATGAILTLRAARDMVRRDLEFGIVTMCIGGGQALAALLKRV"
     atggggacaa tcatgaccac acccgaaccg atcgtcatcg tcgacggggc caggaccccc        60
     gtcggtagct tcggcggcgt cttcaaggac gtacccgcac acgagctggg tgccgcagca       120
     gccaaggcag cgctgagccg cgccggcgtt gcacccgaag acatcgacga ggtcgtcatg       180
     ggctgcatcg gccaggtcgg cccagacgcc tacaacgcac gccgcgtggg catcgccgcc       240
     ggactgcccg agaacgttcc cgcctacacc gtcaaccgcc tctgtggcag cggcctgcag       300
     gccgtatggt cggcggcgat gcagatgcgc tggggcgcag ctgccatcac cctcgccggc       360
     ggcgacgaga gcatgtcccg catgccgttc tacgacttcg ccgcccgctc gggctacaag       420
     ctcggcgatc gcagcctcgt cgacggcacc gtcgccatgc tcaccgaccc gttcagcaag       480
     gctcatatgg gccgcaccgc cgaagccgtc gcccgcaagt acggcgtcag ccgcgagcag       540
     caggacgagt tcgccgtgga atctcagcgc cgcgctgcta ccgacgcagc caaggcagca       600
     ttcgccgagg agatcactcc cgtcgagacc ggtggtcggc gctccgtcac cgtcaccgaa       660
     gacgagcacc ccaagcccgg aaccactgtc gaaaccctcg ccaagctgcg ccctgcattc       720
     gaagagggcg gatccgtcac cgccggcaac gcgtcgggca tcaacgacgg cgccggcgca       780
     cttgtcctcg ctacaggaac cgaggcagcc aagcgcggcc tcaccggact cgtcacgctc       840
     gaaactgtca cgacggcagc catggagccc ggcctgatgg gctacgctcc cgtgctcgct       900
     ctcgaaaagc tttttgcaca aacaggattg aagccgtccg acatcggcac cgccgaggtc       960
     aacgaggcct ttgcttcgca ggccatcgcc gtcatccgtg acagtggcct ggatccggag      1020
     aagaccaacc cgtacggcgg agcaatcgcc ctcggacacc cggtcggcgc taccggagcc      1080
     atcctcacgc tgcgcgcggc acgcgacatg gtccgtcgcg acctcgaatt cggcatcgtc      1140
     accatgtgca tcggcggcgg tcaggcactc gctgccctgc tgaagcgggt ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page