(data stored in ACNUC1104 zone)

EMBL: AP008957.PE224

AP008957.PE224       Location/Qualifiers
FT   CDS_pept        261034..261966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02240"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30932"
FT                   /db_xref="GOA:C0ZLV5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV5"
FT                   /protein_id="BAH30932.1"
FT                   /translation="MTAQTPTPTRTPRGRIDPRLLVVGGAAAISISSLLIKLADVGPST
FT                   AVFFRCFLALPPLLWLAWREFRRVGKPSRRAVVLQVLGGLLLGLDFALWSQSILMIGAG
FT                   MASVVVNVQVIVVPALSWLVFGNRVPMRFVFALPFMFTGIALAGGVFGGGGTGDELLWG
FT                   TALSLVSGIAYGGYIFVVGRTGEADRAASQVLISTTSAGIAGSVIGSLWGRIDFVPGWE
FT                   AFGWLAALALVGQVFGWMLMGHSLPRLPAEVGATLLLMQPVLAVLLAVVLLGERPGVGQ
FT                   LLGCVVVVGAVSAVSIRRTRAVTRVGSAG"
     gtgactgcac agacaccgac acccaccaga actcctcggg ggcgcatcga ccctcgattg        60
     ctggtcgtcg gaggcgcagc cgcgatctcg atcagttcgc tcctcatcaa gctggctgat       120
     gtcgggccct cgacggccgt cttcttccgt tgcttcctgg ccttgccgcc gctgttgtgg       180
     ttggcgtggc gagagttccg ccgggtgggc aagccgagcc ggcgggcagt cgttctgcag       240
     gtgctcggcg gtctgttgct cggactggat tttgcgttgt ggtcgcagtc gattctgatg       300
     atcggcgcgg gtatggcgag cgtcgtcgtg aacgtgcagg tgatcgtggt gcccgcactg       360
     tcctggttgg tgttcggcaa tcgggtgccg atgcgcttcg tcttcgccct accgttcatg       420
     ttcacgggaa tcgccttggc gggcggcgtg ttcgggggcg ggggaaccgg cgacgaactg       480
     ctgtggggaa cggcgctctc gctcgtctcc ggaatcgcgt acggcggtta catcttcgtg       540
     gtcggccgta cgggcgaggc ggatcgggcc gcgagccagg tgttgatctc gacgacgtcc       600
     gcgggcatcg ccggctccgt catcggatca ctgtggggcc ggatcgattt cgtcccgggt       660
     tgggaagcgt tcggctggct cgcggcactg gcgctggtcg gccaggtgtt cggctggatg       720
     ctgatggggc actcgctccc tcggctgccc gccgaggtgg gcgcgacgct cctgctcatg       780
     caaccggtcc tcgccgtact gctggcggtt gtgctgctcg gcgaacggcc gggcgttggg       840
     caactactcg ggtgcgtcgt cgttgtcgga gcggtctcgg ccgtctccat acgtcgcacc       900
     cgagcagtca cccgagtagg tagcgcaggc tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page