(data stored in ACNUC1104 zone)

EMBL: AP008957.PE227

AP008957.PE227       Location/Qualifiers
FT   CDS_pept        complement(268679..268948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02270"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30935"
FT                   /db_xref="GOA:C0ZLV8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV8"
FT                   /protein_id="BAH30935.1"
FT                   /translation="MVRVPLTAEELERGLRLGELLRSARGDRSMVQVALDAGISVETLR
FT                   KIETGRIATPAFFTISAVAEVLGISLDTIARTLETPQSEQEVAS"
     atggtgcgcg tgccgctgac ggcggaagaa ctcgaacgag gactacgact gggtgaactc        60
     ctgcgatcgg cgcgggggga ccgaagcatg gttcaggtag cgctcgacgc cggtatctcc       120
     gtcgaaacgc tgcgcaagat cgaaaccgga cgcatcgcga cacccgcctt cttcaccatc       180
     agcgcggtcg cggaagtgtt gggtatttca ctcgacacca tcgcccgaac acttgaaaca       240
     ccacaatccg aacaggaagt tgcatcctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page