(data stored in ACNUC1104 zone)

EMBL: AP008957.PE231

AP008957.PE231       Location/Qualifiers
FT   CDS_pept        complement(272634..273260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30939"
FT                   /db_xref="GOA:C0ZLW2"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW2"
FT                   /protein_id="BAH30939.1"
FT                   /translation="MSELVTQSRELVPHRAVLDSAEHVLVIARGKPFGREQAFHEVLSV
FT                   AIRNRIEVLTLARALIDVSESRDYRAIPTDTAHTVAVLEWGELLEIPTEHHEKSRAESA
FT                   GDADETNDFDDPIEPEYLVETDVGGRVVFVALAFTIGGIVGFFAHDWALLLLITAVYLV
FT                   WIAARLVAKLVSVSRSAHWADAEPIRGTDSTTHNAERSHHHAVAA"
     gtgagcgaac tcgttacgca aagccgcgag cttgtaccgc atcgtgcagt tctcgattcc        60
     gcagaacatg ttctggtcat tgcgcgcggc aaaccgttcg ggcgcgagca ggccttccac       120
     gaagtgttga gcgtcgcgat tcgcaatcgc atcgaagtac tcactctggc aagggctctc       180
     atcgacgttt ccgagtcccg cgactaccgc gcgatcccga ccgacaccgc gcacaccgtt       240
     gcggtgctcg aatggggtga gctactcgag atcccgaccg aacaccacga gaagtccaga       300
     gccgaatcgg ctggagacgc cgatgaaacg aacgacttcg acgatccgat cgagccggag       360
     tatctggtcg agaccgacgt gggcggacgc gtcgtcttcg tcgccctcgc gttcacgatc       420
     ggcgggatag tcggattctt cgcgcacgac tgggcgcttc tgcttctgat caccgccgtg       480
     tacctcgtgt ggatcgcggc acggctggtc gcgaaactcg tcagtgtttc ccgcagtgcc       540
     cattgggcgg acgccgagcc tattcgtggc accgattcga caactcacaa cgcggaacgc       600
     tcccaccacc acgctgttgc agcgtga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page