(data stored in ACNUC1104 zone)

EMBL: AP008957.PE241

AP008957.PE241       Location/Qualifiers
FT   CDS_pept        282379..283311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30949"
FT                   /db_xref="GOA:C0ZLX2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX2"
FT                   /protein_id="BAH30949.1"
FT                   /translation="MKLATVEYEKTQQTALVTGSGEQLLLLERAHHDVTGKPAPELETM
FT                   QTIIEGGPAAREILDRLADEQPASAIVDAGDVRWMSPLPQPVQIRDFGCFMDHFRNARA
FT                   RIQGVALEDVELPKIQLERPLYYIANRLAVTGHESEVVWPEYSSLRDYELEFACVLGRG
FT                   GSDISRADAPAHIFGYTIFNDFSARDTQLEEISTGLGLSKSKDFSNANVLGPWIVTADE
FT                   VGDPYQLEMTARINGDEVSRGTSADMDHRFEDVISFASTSTRLYPGEVFCSGTVPSGCG
FT                   LEHGRFLEPGDVVELEVAGLGVLRNRVVA"
     gtgaaacttg cgaccgtcga atacgaaaag acccagcaga cggctctggt gacgggcagc        60
     ggcgagcaac tgttgttact cgagcgagct catcatgatg tgacgggaaa accggctcca       120
     gaactggaaa ccatgcaaac catcatcgaa ggtggtccgg cggcacggga gatcctggat       180
     cggctggcag acgagcagcc ggcaagtgcg atcgtcgacg cgggtgatgt gcgctggatg       240
     tcgccgcttc ctcagccggt ccagatccga gacttcggct gcttcatgga tcacttccgc       300
     aacgctcgcg cccgaattca aggggtcgca ctcgaggacg tcgaactgcc gaagatccag       360
     ttggagcgcc cgctgtatta catagcgaac cgattggcgg tgaccggaca cgaatctgag       420
     gtcgtgtggc ccgagtactc gagcctgcgc gattacgaac tcgaattcgc ctgtgtgttg       480
     gggcgcggtg gaagcgacat ctcacgagcg gatgcccctg cgcatatctt cggttacacc       540
     atcttcaacg atttcagcgc ccgcgatact cagctcgagg agatctccac cggactcggt       600
     ctcagtaaga gcaaggactt ttcgaacgcg aatgtcctcg gcccctggat cgtgacggcc       660
     gacgaagtcg gagacccgta ccagctcgag atgaccgcga gaatcaacgg agacgaggtg       720
     agccgaggaa ccagcgccga catggaccat cgtttcgagg acgtgatttc gttcgcctcg       780
     acttccacgc ggctgtaccc gggtgaagtc ttctgttccg gcaccgtgcc gagtggatgc       840
     ggcttggaac acgggcggtt cctcgaaccg ggagacgtag tcgaactcga ggtcgccggc       900
     ctcggtgtat tgaggaatcg agtggtggcg tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page