(data stored in ACNUC1104 zone)

EMBL: AP008957.PE242

AP008957.PE242       Location/Qualifiers
FT   CDS_pept        283308..284546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02420"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="protein synonym:acyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30950"
FT                   /db_xref="GOA:C0ZLX3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX3"
FT                   /protein_id="BAH30950.1"
FT                   /translation="MSGEVMVLGVGATPFGRHADTSASELAGRAAIDAVEDAGLTRGDV
FT                   GAVFYATVSQKAIDRQHMIPGQIALRPYGFGGVPVVNVENACAGGATALWLAIAHVRAG
FT                   LSEVALAVGVDKLVCSDPARSLEVFDGALDVAHRDETLAGLASLSAPVPGELGSQGERS
FT                   VFMEIYASLARAHMERFGTTEFELASVAAKNHAHSVHNPWSHFRKPFTVDEVLAARRVA
FT                   WPLTVPMCSPVSDGAAAIVVTTADFARRHDSSRRAARVLGCSLVSGTDRAADDVESHIG
FT                   RRAAMSAYEEAGVGPGDVDVAEVHDATAFGEVQQVENLGFCPIGEGGAWSASGASSLGG
FT                   VRPVNPSGGLESRGHPVSATGLAQVFELVTQLRGQAARRQVPGARIAVAENGGGLYGIE
FT                   EAVAAVTILGGPR"
     gtgagcggcg aagtcatggt tctcggtgtc ggcgcgactc ccttcgggcg gcacgcggat        60
     acctcggcct cggaattggc ggggcgtgca gcgatcgacg ccgtcgaaga cgcgggcctg       120
     acccgcggtg acgtcggtgc agtcttctac gcgaccgtca gtcagaaggc gatcgaccgg       180
     cagcacatga tcccaggcca gattgccttg aggccttacg gtttcggtgg agtcccggtc       240
     gtcaatgtcg aaaatgcctg cgccggcggg gcaacggcac tctggctggc gatcgcccac       300
     gttcgcgccg gtctgtccga ggtcgcattg gcggtcgggg tggacaagct ggtgtgctcg       360
     gatcccgctc gaagtctgga ggtgttcgac ggtgcactcg acgttgcgca tcgcgacgag       420
     acgctcgccg gccttgcctc actctccgct ccggtgccgg gtgaactcgg atcgcagggt       480
     gagcggtcgg tgttcatgga gatctacgct tctcttgctc gggcgcacat ggagagattc       540
     ggaacgaccg agttcgaact cgcgtccgta gcagccaaaa atcatgcgca ctccgtgcac       600
     aatccgtggt cgcactttcg caaacccttc actgtcgacg aggtgcttgc cgcgaggcga       660
     gtcgcgtggc ctctgaccgt tccgatgtgt tcgcccgtca gtgacggtgc ggcggcaatt       720
     gttgtgacca ctgcagactt tgcgcgaagg catgattcct ctcggcgggc ggcgcgggta       780
     ctcggttgca gcttggtgtc aggcacggat cgggccgcag atgacgtcga gagtcacatc       840
     ggtcgccgag cggcaatgag cgcatacgag gaagccggag tcgggccagg cgatgtggat       900
     gtggcagagg tccacgacgc cacggccttc ggtgaagtac agcaggtcga gaatttgggg       960
     ttctgcccga tcggtgaggg cggcgcgtgg tctgcgtccg gtgcgagttc attgggaggc      1020
     gtgcgtccgg tcaatccgtc aggtgggctc gaatcccgtg gtcatccggt ctcggcaacg      1080
     ggactagcgc aggtcttcga acttgtcacg cagttgcgtg gacaagcagc gcggcgacag      1140
     gttcccgggg ctcgaatcgc ggtcgcagag aacggcggag gtctctacgg catcgaggaa      1200
     gccgtcgccg cggtcacgat cttgggaggg ccacgatga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page